LOCUS       LC315809               15401 bp    DNA     linear   BCT 02-MAR-2018
DEFINITION  Staphylococcus aureus genes for island SaPISaitama2, complete
            sequence, strain: Saitama2.
ACCESSION   LC315809
VERSION     LC315809.1
KEYWORDS    .
SOURCE      Staphylococcus aureus
  ORGANISM  Staphylococcus aureus
            Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae;
            Staphylococcus.
REFERENCE   1  (bases 1 to 15401)
  AUTHORS   Uehara,Y., Sasaki,T., Baba,T., Furuichi,M., Kawada,M. and
            Hiramatsu,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-2017) to the DDBJ/EMBL/GenBank databases.
            Contact:Yuki Uehara
            Juntendo University, Department of Infection Control Science;
            2-1-1, Hongo, Bunkyo-ku, Tokyo 113-8421, Japan
REFERENCE   2
  AUTHORS   Uehara,Y., Sasaki,T., Baba,T., Furuichi,M., Kawada,M. and
            Hiramatsu,K.
  TITLE     Regional epidemic of ST834 community-associated
            methicillin-resistant Staphylococcus aureus among Japanese children
  JOURNAL   Unpublished (2017)
COMMENT     
FEATURES             Location/Qualifiers
     source          1..15401
                     /collection_date="2011-08-20"
                     /country="Japan"
                     /db_xref="taxon:1280"
                     /host="Homo sapiens"
                     /isolation_source="skin"
                     /mol_type="genomic DNA"
                     /note="ST834 CA-MRSA"
                     /note="Staphylococcus aureus genomic island SaPISaitama2"
                     /organism="Staphylococcus aureus"
                     /strain="Saitama2"
     repeat_region   1..15
                     /note="SaPISaitama2 attachment site"
                     /rpt_type=direct
     CDS             complement(128..1234)
                     /codon_start=1
                     /gene="int"
                     /product="integrase"
                     /protein_id="BBD13343.1"
                     /transl_table=11
                     /translation="MTHNLNLSHNIYKDTKRGTYYFRITYYDKSNTRKYITRKGFKQR
                     KDAVKKCNEMMDELEGVGHLNRLPFDKLVEEYIDWYSARRKTSSVKALKTHTNNHLLP
                     YFKSMDVFKMTTQDVMKFQNKKLKEGHSGEYLKKMHVYLVSLLNHAMKFHELKQNVAS
                     LVGNFEIESQKRLNYWTLEQFNQFYDALATQQQKLFFKLLFYSGARKGEIRALTWRDV
                     NFEDEFIHINKTDYHGEVTAPKTKSAIRDIYLPTHMMYDIKDYLIWYKENNIYKDDYV
                     LFGTFYKAYSESTIDRWFTNALKVLDEQLPNGQNFPRIVIHELRHSHASMLVNLGASV
                     MIIAQRLGHSDTTEVYNRYGHLYPSTQKEIVKYL"
     CDS             complement(1224..2027)
                     /codon_start=1
                     /product="transcriptional regulator, XRE family"
                     /protein_id="BBD13344.1"
                     /transl_table=11
                     /translation="MDKKTDIGLRIKSIRLAKGLNLREFGEEISKLTKEKKYISDSIV
                     SRWEKGVSIPNAKRLKAIAEYGNVSINFLLYGNEVSYEDIYQNIQSVNMKNNIQDKLI
                     DFIVNYMPSSEQNTYYFKVASLITIINDHTDSNIDCIIEQMYSFISNENMTFYHHGVY
                     LLLNEDFKKLPVQLYLTEFIYHLLIQISLKYPEVYFLNLLSQFDDLKNNIQEISTKHE
                     ILHNHTRRSKIAEFIDSKEYQKLMNKIDVMKEKLLNKNILKKQGDTHDT"
     CDS             2163..2366
                     /codon_start=1
                     /product="transcriptional regulator"
                     /protein_id="BBD13345.1"
                     /transl_table=11
                     /translation="MNKVLGYRKMLNFTQQQMAKELKISEQSYRNKEKGKTEFKKEEM
                     LTFKNILISKGMTNITLDDIFFN"
     CDS             2402..2620
                     /codon_start=1
                     /gene="xis"
                     /product="DNA-binding protein"
                     /protein_id="BBD13346.1"
                     /transl_table=11
                     /translation="MTKLAYPMLYITRKEKGDTQKKVASKLGISPQRYQLKESGKAIF
                     NLNECQILSEMYDMPIDELFSSKIKVGK"
     CDS             2632..2778
                     /codon_start=1
                     /product="putative terminase"
                     /protein_id="BBD13347.1"
                     /transl_table=11
                     /translation="MKMYLTYICLVSLLTILLLAISNMYVAFSVYGMMATYGFNLTGG
                     LENE"
     CDS             2771..2980
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BBD13348.1"
                     /transl_table=11
                     /translation="MNNEQKEVIEHVVYQLELSIMNNFESYEHTEYVDGIEVVSEISR
                     EKHLELIMKWCAQELKNNFQLEKGE"
     CDS             2983..3300
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BBD13349.1"
                     /transl_table=11
                     /translation="MNWEIKDLMCDIEVIKEKINDVAIKHGWFVEDKFVKNELETKQE
                     HINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKFHEIEKASSENFGEESDDAKKLK
                     ITE"
     CDS             3367..4236
                     /codon_start=1
                     /gene="pri"
                     /product="primase C terminal 1"
                     /protein_id="BBD13350.1"
                     /transl_table=11
                     /translation="MNEIKLEYDTHVSVVHYESLDSRSFKSFSKPKWSKLINKLSVPI
                     EANYKYARGVAVYGDIKNGANDHGEIIKKHRNDVNVVYRDVIVLDYDEINDLKQLHEA
                     ISSALSNVAWFWHTSYSHRTEQARIRLYIPLNERISADDYRKYSKVLANKIGHKVDEG
                     SYQPSRCFALPVIQKGHIFIKRVNDCPIIDVDMLEQWSKELEQSNASPNVIGYTRRDS
                     AYWRELSFGTTEGNRNNALASLVGHLLRCRVNDYIVYSYALLWGQFACKPPMKEQEIN
                     ATFQSILNKHYNN"
     CDS             4250..5950
                     /codon_start=1
                     /gene="rep"
                     /product="replication initiator"
                     /protein_id="BBD13351.1"
                     /transl_table=11
                     /translation="METGKSDVLDKIEKINKKDSALQEIIPKGYEIEHHQCGVALYQL
                     IPSKKEGEPDKKVFITNTIPQITERFEDIESNEVSFNMLFYDNKTPVNIAVSAEEISD
                     SRQLLKLVNKKLDVTSSTSTKLVDYINVSKRYNPPLNVKVATRLGHVKGYFIYPYQEV
                     MKDSNIKLFSNDKGFQKLIDSFQSKGTLEGYSKKVFGQIKDLPMVMVMLYASLGSVLL
                     REFGLQPFIVEISGSTSTGKTFTLNLVSSVWGTSDLITTWSSTQNSIESMASFLNSFP
                     MFKDDTRNTHPKFVTSATYNFSSGESKSRSNINLTLNAKKEWRNILISTGESSIANMA
                     DEKAGVSARVVTLQDQPYPDNFDFTTLDKSFRENYGTLGLAFIKQYESKKDVYKNAFE
                     SYQRYFNQKGSNEIMQRLGRAFALLQVTGEVLNDIDGFEHDHFKIIEQAYDSMVKNNK
                     TIDKPKQLLEELLQYLDANRNNIAGDGYSSVKNGDIKAIYKRDYLCILGQTVYDKLGH
                     EMQTITGQWDKKGYLITSKDRIQKEVRFNSQKNRGYAIKDEIIKELGFDFSNSHNPYN
                     "
     CDS             6280..6660
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BBD13352.1"
                     /transl_table=11
                     /translation="MDKEQLKKYIYDYVKEYKEIPIYQLEDLFKELNHDYIGRTSITH
                     DKDENIVFWSGWNKITMFALIELVKSEQLDLVYRGSFVMRYLLDGRVPNLPLAICYPE
                     DGQQTDVPSWVPMVLRINKEEKIK"
     CDS             6657..7298
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BBD13353.1"
                     /transl_table=11
                     /translation="MNIETIVNQFETRAGTLLRYYTGLLEHSKVQPCCFKLYNDPFDM
                     VYVTMNGKLFGHVYIKDCKVRQSFELASPKHTEGLIRSIEGHYVGYELHDGKQLSISD
                     MMASHLFEDEYFMYGLQTYAESNNSDVFEYLKNGFDTDTLEGIQSSNTDVIANIEMLY
                     QLATGINEPAPELVEGLRLVTEFVQDENATQEDYKALESKLNDLKESYYSLSK"
     CDS             7747..8088
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BBD13354.1"
                     /transl_table=11
                     /translation="MQSIAEKETYHLPTEHLQVFNVIKNTSNKYITKTKILNQLGYEY
                     NSSNERWLRRVINSLVYDYGYPIGCSYKPSERGYYIITTEQEKQQAMRSIKKLADGSM
                     KRYEALKRIKV"
     CDS             8100..8678
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BBD13355.1"
                     /transl_table=11
                     /translation="MKTESYFKEYNQFVIDQQKAIQELEQERNALESKIKIDKSTYKQ
                     LIMDGQDDKADNLYQATDADEKKLKALNKRLETKKSVSKEVKYQKTIELLKHQSELSS
                     LYESEKQSALGKLKKVVDAYNEIIDEIEDINDRYEDEHQQYASIYSQEQLYDDKEARE
                     ALNGYFRENIFTSYINGNDLPYEHNNKLFLKR"
     CDS             8696..8914
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BBD13356.1"
                     /transl_table=11
                     /translation="METKYELNNTKKVANAFGLNEEDTNLLINAVDLDIKNNMQEISS
                     ELQQSEQSKQKQYGTTLQNLAKQNRIIK"
     CDS             8965..9492
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BBD13357.1"
                     /transl_table=11
                     /translation="MKLLKTKNCLYYRNGDNKLSEYQLLTQFNPAFINKKIKMCEFQI
                     ESMYHMSASTTTCDEIMGVVSVSYPIEKLVIKIIETKAGLQNYKNRSINNMALLKKVL
                     NHYTEKEQKKVVKYMRSNGRYKPYNVIERLQVDLYQASIKQRSERQKQRNTAIENSKI
                     ARVNAYHQSSHVKVV"
     CDS             9495..9836
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BBD13358.1"
                     /transl_table=11
                     /translation="MDKKQIKDFVCDYHKRTKSDVLIDDEINTDEFFSIGDENSNKWM
                     ADDNIDDHIVKNHLEMIVDQVANDKEFYIFDSLIQGRSFKDISNVLECSEQSVILWYE
                     TLLDKIVEVIE"
     CDS             9833..10402
                     /codon_start=1
                     /gene="ter"
                     /product="putative terminase"
                     /protein_id="BBD13359.1"
                     /transl_table=11
                     /translation="MSELTAKQARFVNEYIRTLNVTQSAIKAGYSANSAHVTGCRLLK
                     KPHIKQYIQEQKDKVIDENVLTAKELLHVLTNAAVGDETETKEVVVKRGEYKENPQSG
                     KVQLVYNEHVELVEVPIKPSDRLKARDMLGKYHKLFTDKHDINGNLPIFINIGEWDGD
                     DEDLDKTVQEVSNTNPNHTVIVDDIPLED"
     CDS             complement(10557..11261)
                     /codon_start=1
                     /gene="tst"
                     /product="toxic shock syndrome toxin-1"
                     /protein_id="BBD13360.1"
                     /transl_table=11
                     /translation="MNKKLLMNFFIVSPLLLATIATDFTPVPLSSNQIIKTAKASTND
                     NIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKV
                     DLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYWPKFD
                     KKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEK
                     PPINIDEIKTIEAEIN"
     CDS             complement(12138..12698)
                     /codon_start=1
                     /product="secreted protein Ear"
                     /protein_id="BBD13361.1"
                     /transl_table=11
                     /translation="MNKKLLTKTLIASALVLTTVGSGFHSSSNYNGINNVAKAEQTTD
                     NALWKNVRDALKDANIIDKTDNENVKVTYKIENGGENTIEGTANLENISTSNNPKINP
                     QNVTKINITRKNSNYPNIDANNTWKKLTEKLKEKNIVNNGDNVSILSTDPKDETVFGK
                     VGEDKSNVSNRYINPKDINEIQITKK"
     CDS             13486..14286
                     /codon_start=1
                     /gene="sec"
                     /product="superantigen enterotoxin SEC"
                     /protein_id="BBD13362.1"
                     /transl_table=11
                     /translation="MYKRLFISRVILIFALILVISTPNVLAESQPDPMPDDLHKSSEF
                     TGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAK
                     KYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLV
                     RVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIEN
                     NGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG"
     CDS             complement(14454..15176)
                     /codon_start=1
                     /gene="sel"
                     /product="superantigen enterotoxin SEL"
                     /protein_id="BBD13363.1"
                     /transl_table=11
                     /translation="MKKRLLFVIVITLFIFSSNHTALSNGDVGPGNLRNFYTKYEYVN
                     LKNVKDKNSPESHRLEYSYKNDTLYAEFDNEYITNDLKGKNVDVFGISYKYGSNSRTI
                     YGGVTKAENNKLDSPRIIPINLIINGKHQTVTTKSVSTDKKMVTAQEIDVKLRKYLQD
                     EFNIYGHNDTGKGKEYGTSSKFYSGFDKGSVVFHMNDGSNFSYDLFYTGYGLPESFLK
                     IYKDNKTVDSTQFHLDVEISKR"
     repeat_region   15387..15401
                     /note="SaPISaitama2 attachment site"
                     /rpt_type=direct
BASE COUNT         5630 a         2054 c         2675 g         5042 t
ORIGIN      
        1 tcccgccgtc tccattatat agtctgcgac cttagtggtt gtaggctttt tatttttgag
       61 tgcacagata gtgcacagaa aatgcacagg atataaaaag acaccaccaa ttttagttgg
      121 tagtgcctta taagtattta actatttctt tctgtgtact aggatataaa tgaccatatc
      181 ggttatatac ttcagtcgta tcgctgtgac ctaaacgctg agctataatc attacactag
      241 cccctagatt aactagcata gatgcatggc tatgtcttaa ctcgtgtata acgattctag
      301 ggaaattttg tccgtttggt aattgctcat ccaacacttt taatgcgtta gtaaaccaac
      361 gatcaatagt agactcgctg taagctttat agaatgtacc aaacaataca tagtcgtcct
      421 tgtatatgtt attctcttta taccaaatta aataatcttt gatgtcatac atcatgtgag
      481 taggcaaata tatatcacgt atggctgatt tcgttttagg ggctgtcact tcaccgtgat
      541 agtccgtttt gtttatatgg ataaattcat cttcaaaatt aacgtcacgc catgtgagag
      601 ctctaatttc gccctttctt gctccagagt agaacaatag tttgaaaaat aatttttgtt
      661 gttgtgtagc aagcgcatca tagaattgat tgaattgttc taacgtccaa taattcaatc
      721 gtttctgtga ttctatttca aaattcccta caagagatgc aacattttgt tttaactcat
      781 gaaacttcat tgcatgattc agtaatgata ctaaatatac atgcatcttc tttaaatatt
      841 ctccagaatg cccctctttt aacttcttat tctgaaattt catcacatct tgtgtagtca
      901 ttttaaatac atccatagat ttaaaataag gtagcaaatg gttattggta tgtgtcttta
      961 atgcttttac acttgatgtc tttcgacgtg ctgaatacca gtctatatat tcttcaacga
     1021 gcttgtcaaa aggtaatcta ttaaggtgtc cgactccctc taattcgtcc atcatttcgt
     1081 tacatttctt tactgcatct ttacgttgtt taaacccctt acgtgttatg tacttacgag
     1141 tattgctctt gtcatagtaa gtgatacgga aataataagt accgcgttta gtgtctttat
     1201 atatattatg ggatagattt aagttatgtg tcatgagtat cgccttgttt ttttaaaata
     1261 tttttattga gtaacttttc tttcataaca tcgattttat tcattaattt ttggtattct
     1321 ttagagtcta taaattctgc tattttactt cttctagtat gattgtgtaa tatttcatgc
     1381 ttagttgaaa tttcttgtat attatttttg aggtcgtcaa attgcgacaa caagtttaaa
     1441 aagtagactt caggatattt taatgaaatt tggattaata aatgataaat aaattcagtg
     1501 agatataatt gtacaggtaa ttttttgaaa tcttcgttta gcaataaata aacaccgtga
     1561 tggtaaaatg tcatgttctc atttgagatg aatgaataca tttgttctat tatacaatct
     1621 atatttgaat ctgtatgatc attaataatt gtaattaaac tagctacttt aaaataataa
     1681 gtattttgct cactagaggg catataatta acgataaaat caattaactt gtcttgaata
     1741 ttgtttttca tattcactga ttgtatgttt tgataaatat cttcgtatga aacctcattt
     1801 ccatatagta aaaaattaat agacacatta ccatattctg caatagcttt taaccttttg
     1861 gcattgggta ttgacacccc tttttcccat cgactaacta tactatccga aatatatttt
     1921 ttttcttttg ttaattttga tatttcttcg ccaaattctc ttaaattcaa tcctttagca
     1981 agtctgatac ttttgatgcg taaaccaata tctgtttttt tatccatatt ttcacttcct
     2041 atctaatgag aatatccata aaaactttcg taaaccgacg tttttgtgtt gcttttagtt
     2101 ttcgtgtctg ttatattata catacagacg agaacttacg tctagggaag aggtgataat
     2161 aagtgaataa agtactgggt tataggaaaa tgttgaactt cacacaacaa caaatggcaa
     2221 aagagcttaa aatatcagaa cagtcataca gaaataaaga aaaaggaaaa acggaattta
     2281 agaaagaaga aatgttaact tttaaaaaca tacttatttc aaagggaatg accaatataa
     2341 ctttagatga tatttttttt aattaaaatc cgacgtaaaa ctacgtaaaa gaggtggtca
     2401 aatgacaaaa ctagcttatc caatgttata cattactaga aaagaaaagg gtgacacaca
     2461 aaagaaagtt gctagcaaac ttggtattag tccacaacgc taccagttaa aggaaagtgg
     2521 caaggcaata tttaatttaa atgagtgtca gattctttca gaaatgtatg atatgccaat
     2581 tgatgagttg ttttcatcaa aaattaaagt aggaaaatag gaggcaaggc aatgaaaatg
     2641 tacttaactt atatttgctt agtttcattg ttaacaattt tattactagc aatatctaac
     2701 atgtatgtcg cttttagtgt gtacggcatg atggcaactt atggatttaa tttaacagga
     2761 ggattagaaa atgaataatg aacaaaaaga agtaatagaa cacgtggttt atcaacttga
     2821 gttaagtatc atgaataatt ttgaaagtta tgaacacacg gaatatgttg atggtattga
     2881 agtggtttca gagatcagtc gtgaaaagca cttagaattg ataatgaaat ggtgcgcaca
     2941 agaattaaag aataattttc aattagaaaa aggagaataa atatgaattg ggaaattaaa
     3001 gatttgatgt gtgatattga agtgataaaa gaaaaaatca atgatgtagc tatcaaacat
     3061 ggttggtttg ttgaagataa atttgtcaaa aatgaattag aaacaaaaca ggaacatatt
     3121 aatttttctg ctagctattt agaacatcgt atacaaaatg aacatacagt tgagttatta
     3181 caggtgtact taaaagaatt cggtgaactt atacaaaagt ttcatgaaat agaaaaagca
     3241 tcatctgaga actttggcga ggaatcagat gacgcaaaga aattaaaaat tacagagtaa
     3301 ttaataaaaa ataactattt ttattataac atctttgctc tgttgtttca ttaagaggta
     3361 caaaaaatga atgaaattaa attagaatat gacacacatg tttcagtggt acattatgaa
     3421 agtttagact cacgttcatt taagagcttt tcaaaaccta aatggagtaa gttaattaat
     3481 aaactgtctg tgcctataga agcaaattat aagtatgcac gtggtgttgc tgtttacggt
     3541 gatattaaaa acggtgcaaa tgatcatggt gaaattatca aaaagcatcg caatgacgtt
     3601 aatgtcgtat acagagatgt gattgtactt gattacgatg aaataaatga tttaaagcaa
     3661 ttacatgaag caatcagctc agctttaagc aatgttgcat ggttttggca cacaagttac
     3721 tcgcacagaa ctgaacaagc tagaatacgc ctgtatatcc ctctaaatga gcgaataagt
     3781 gcagatgatt atcgtaaata ttcaaaggta ttagcaaaca aaattggtca taaagttgat
     3841 gaaggttcat atcagccaag tagatgtttt gcattaccag ttattcaaaa agggcacata
     3901 tttattaagc gagtgaatga ctgtccaatt atcgatgttg atatgctcga acagtggtcg
     3961 aaggaacttg aacaatcaaa tgctagtcct aatgttatag ggtacacgcg acgtgatagt
     4021 gcgtactggc gtgagttaag ctttggaaca actgaaggca atcgtaacaa tgcactagct
     4081 agcttagtgg ggcatttatt aagatgtcgc gttaatgatt atattgtgta ttcatatgct
     4141 ttattatggg ggcaattcgc atgtaaacca cctatgaaag aacaagaaat caacgcaact
     4201 tttcaatcga tattaaataa acactataac aattagaaag gggctttgta tggaaacagg
     4261 taaaagtgat gtacttgata aaattgaaaa aattaataaa aaagatagtg ccttacaaga
     4321 aattataccg aaaggctatg aaattgaaca tcatcaatgc ggtgttgctt tatatcaact
     4381 tataccaagt aaaaaagaag gcgaaccaga taaaaaggtt tttatcacaa atacaatccc
     4441 tcaaattact gaacgctttg aagatattga gagtaacgaa gtcagcttta atatgctttt
     4501 ctatgacaat aaaacgcctg taaatatagc agtgagcgcc gaagaaattt cagatagtcg
     4561 tcaactcttg aaattggtta ataaaaagct agatgtaaca tcgtcgacat ctactaaact
     4621 tgttgactat attaatgtat ctaaacggta taatccacca ttaaatgtta aagttgcaac
     4681 gcgcttggga catgtgaaag gttattttat ttatccttat caagaagtga tgaaagacag
     4741 caatatcaag ttgtttagta atgataaagg atttcaaaag ttaatagact cttttcaaag
     4801 caaaggaaca ttagaaggtt actctaaaaa agtgttcggt caaataaaag atctaccaat
     4861 ggtaatggtt atgttatatg catctttagg ctcagtttta ttaagagaat ttggattaca
     4921 accctttatt gtagaaatat caggtagtac atccacaggt aaaacattca cactcaactt
     4981 agtatcaagt gtttggggaa ccagtgacct tattacgaca tggagttcta ctcaaaatag
     5041 tattgaatca atggcatcat ttttgaactc atttccaatg tttaaagatg atacacgtaa
     5101 tacacatcct aagtttgtta ccagtgccac atataacttt tctagtggcg aaagcaaatc
     5161 aagaagtaat attaatttaa cgctaaatgc taaaaaagaa tggcgaaata ttttaatttc
     5221 tactggtgaa tcatctatcg caaatatggc tgatgaaaaa gcgggtgtat cagcacgtgt
     5281 agttacacta caagatcaac catatccaga taattttgat tttaccacat tagacaaatc
     5341 gtttagggag aactatggaa cgttagggtt ggcatttatt aaacaatatg agtctaaaaa
     5401 agacgtgtat aagaacgctt ttgaaagcta tcaacggtat tttaatcaaa aaggtagtaa
     5461 tgaaatcatg caacgtttag gacgtgcctt tgcgttacta caagttaccg gtgaggtttt
     5521 gaatgatatt gatggatttg aacatgacca ttttaaaatt attgaacaag cctatgacag
     5581 catggttaaa aacaataaga caattgataa acctaagcaa ctgttagagg aactattaca
     5641 atatttagat gcaaatagaa ataatatcgc tggtgatggc tatagttcag tcaaaaatgg
     5701 tgacatcaaa gctatatata aacgtgatta tttatgtata ttaggtcaaa ctgtatacga
     5761 caagttaggt catgaaatgc aaactatcac aggacaatgg gacaaaaagg gttatttaat
     5821 aactagtaaa gacagaatac aaaaagaagt tagatttaac tctcaaaaga atagagggta
     5881 tgccattaaa gatgagatta taaaagaatt agggtttgat ttttctaatt cacataatcc
     5941 atataattaa aaaagtcccc aaagtctcca aacagtcccc actaaaaagg aatgattggg
     6001 gacttaataa acactattac cgcaatactt tagagagatt agtccccaaa gtccccaata
     6061 aaaaacagtg tttatataaa atgatcaaaa agaacattga gtgtaattta atatatagct
     6121 accatcgttt ataaatatgg tgactatggg gactatttct aacaaaatca gttatatcaa
     6181 cgggtgaaac agtccccaat aaataattag ggtggggact cactggggac tagtccccta
     6241 ctaaaataaa aaacatcaaa ttaatgctgg aggttacaca tggataaaga acaacttaaa
     6301 aagtatatat acgattatgt aaaagaatat aaggagatac cgatatatca gttagaagat
     6361 ttgtttaaag aactgaatca cgactatata gggagaacta gtatcacaca cgataaggat
     6421 gagaatattg tgttttggag tggatggaac aaaattacaa tgtttgcgtt gattgaatta
     6481 gttaaaagtg aacaacttga tttagtgtat agaggtagtt ttgtaatgcg ttatttgttg
     6541 gatggtagag ttcctaattt accattagct atttgttatc cagaagatgg acaacaaact
     6601 gacgtgccct catgggtgcc tatggtatta agaataaata aagaggagaa aatcaaatga
     6661 acatagaaac tatcgtaaac caatttgaaa cacgagcagg cacgttacta aggtactaca
     6721 caggattatt agaacatagt aaagtgcaac catgttgctt taagttatac aatgatccat
     6781 ttgatatggt ttatgtgacg atgaatggga agttattcgg tcatgtatat attaaagatt
     6841 gtaaagtaag gcaatcattt gaattagcgt cacctaagca cactgagggg cttataagaa
     6901 gcatagaagg tcattatgta ggttatgaat tacatgatgg caaacagctt tctattagtg
     6961 atatgatggc tagtcatttg tttgaagatg agtattttat gtatggatta caaacatatg
     7021 cagaatcaaa taatagtgat gtgtttgaat acctaaaaaa tggatttgat accgatacac
     7081 ttgagggcat tcaatcgagt aatactgatg tgatagcaaa tattgaaatg ttgtatcagt
     7141 tagctacggg aatcaatgaa ccagcaccag agttagttga ggggttgaga ttagtaactg
     7201 agtttgtaca agatgagaat gcgacacaag aggattacaa ggctttagaa agtaaattga
     7261 atgatctaaa agagtcttac tatagcttga gtaaataatg ttatgagggg tcacatgtag
     7321 tgtgtggctc ctaataaaat actacgattt tatacgaggt atagcagttt aaaatggtaa
     7381 ggttttcgga aggtgttggc ttttaaaatc ggaaggtata cagtctttga gaattgaaaa
     7441 aatggcaaga tttgtgcaag gtgtgcgaac tttgttaacg ctaatacaag ctaaagtttg
     7501 tgtttttggc ataggcctaa aagttaagtt tgttcgctgt ttgttcgtgt tactttaccg
     7561 aacttaagtt ctatattagg ttaatgtgaa aagcctaacg ttaagtttat aacataattt
     7621 tataagtgtt atatatgata agctaaacaa ttgataaacg cgctataaag cgaacgtaag
     7681 tttgttttag acctgtaaaa atggtataat ttaggtatga aataattaaa agaaagaggt
     7741 gtagaaatgc aaagtatcgc agaaaaagag acgtatcatt tacccaccga acacctgcaa
     7801 gttttcaatg tgataaaaaa tacgtccaat aagtatatta ctaaaactaa aatcttaaat
     7861 caattgggat atgaatataa ttcaagcaat gaacgatggt tacgaagagt aatcaattca
     7921 ttagtatatg attatggcta tcctatcgga tgcagttata aacctagtga acgtggttat
     7981 tacatcatta cgacagaaca agaaaagcaa caagcgatga gaagtattaa gaaattagct
     8041 gatggcagta tgaaacgcta tgaagctttg aaacgaatta aagtgtaaag gggataaaaa
     8101 tgaaaactga atcgtacttt aaagaataca accaatttgt aatagatcaa caaaaggcta
     8161 tacaagaatt ggaacaagag cgtaatgcat tggagagtaa aataaagata gataagtcca
     8221 catataaaca gttaatcatg gatggacaag atgataaagc agataaccta tatcaagcaa
     8281 cagatgctga tgaaaagaaa ctaaaagcac ttaataaacg cttagagaca aagaaaagtg
     8341 tgtcgaaaga agttaaatat caaaagacaa ttgaattatt aaaacatcaa agcgagttgt
     8401 catcattata cgaatcagaa aagcaatcag ctttaggtaa attaaaaaaa gtagtcgatg
     8461 catataatga gatcattgat gaaatagaag atattaatga tagatatgaa gatgagcatc
     8521 agcaatatgc gagtatttat agtcaagaac aattatatga tgataaagag gctagggaag
     8581 cattgaatgg ctactttaga gaaaatatat ttacatcata tattaatggt aatgatttgc
     8641 catacgaaca caataacaag ttgtttttaa aacgttaaaa agaaagggta attaaatgga
     8701 aacaaaatac gagttaaata atactaaaaa ggtcgcaaat gcatttggtt taaatgaaga
     8761 agatacaaat ctattaataa atgcagttga tttggatatt aaaaacaata tgcaggagat
     8821 ttcaagtgag ttacaacaat cagaacagtc taagcaaaag caatatggta caacgctaca
     8881 aaatttagct aagcaaaaca ggattattaa atagcaatga ttgcctatcc aattcgggta
     8941 ggctctgttt ataggggtga ataaatgaaa ctgcttaaaa cgaagaattg tttatattat
     9001 cgtaatggcg acaataaact atctgagtat caactattaa cgcaatttaa cccagcattt
     9061 attaataaaa aaattaagat gtgtgaattc caaattgaaa gtatgtacca tatgagtgcg
     9121 tcgaccacaa catgtgatga aataatgggg gtcgtgtctg tctcatatcc gattgaaaaa
     9181 ttagttatca aaattattga aacaaaagca gggttacaaa actataaaaa tagatctata
     9241 aataatatgg cgttgttgaa aaaggtacta aatcattata cagaaaaaga gcagaagaaa
     9301 gttgtaaaat atatgcgttc aaatggacga tataagccct acaacgtcat tgaacgttta
     9361 caggttgatt tgtatcaagc aagtattaaa caacgttcag aacgtcaaaa acaaagaaat
     9421 acagcaattg aaaatagcaa gattgcacga gtaaatgctt atcatcaatc ttcacatgta
     9481 aaagtggtgt aacaatggat aaaaagcaaa taaaagactt cgtttgtgat tatcataagc
     9541 gaactaaaag tgatgtgttg atagatgatg aaataaatac cgatgaattc ttttcaatag
     9601 gtgatgaaaa ttctaataaa tggatggcag acgataacat tgatgatcat attgtaaaga
     9661 atcacttaga aatgattgtt gaccaagtag ctaatgataa agagttttat attttcgatt
     9721 ctttaataca aggacgtagt tttaaagata ttagcaatgt cttagagtgt tcagaacaat
     9781 ctgtaatatt atggtatgaa accttattag ataaaattgt ggaggtgata gaatgagtga
     9841 gttaacggca aaacaagcgc gttttgtgaa tgagtatata agaacactta atgtaacaca
     9901 aagtgccata aaagcaggct atagcgcaaa tagtgcacat gtgacaggat gtaggttatt
     9961 aaagaagcca cacatcaagc aatatataca agaacaaaaa gataaggtta tagatgagaa
    10021 tgtattaacc gcaaaagagt tactacatgt gcttacgaat gcggcagtcg gtgatgaaac
    10081 agaaacgaaa gaagttgtgg tcaaacgtgg agaatataaa gagaatccac aaagtggcaa
    10141 agtacagtta gtctataacg aacatgttga actggtagag gtgccaatta agccaagtga
    10201 tcgtttaaaa gctcgtgata tgttgggtaa ataccataag ttatttacag ataagcatga
    10261 tattaacggg aatttgccta tattcattaa tattggtgaa tgggatggcg atgatgaaga
    10321 tttagataag acggtacaag aggtatctaa cactaatcct aatcatactg tgattgtgga
    10381 tgatataccg ttagaggatt gattacagta aaaacgatta tcatattgag ttagtgagga
    10441 ttagtttact aattcaccct agctttatat taaagcgtta taaagataaa agggagaacg
    10501 cttattataa ttaacggact ccctttatta ataattatta cagaaaaagt ggtaaattaa
    10561 ttaatttctg cttctatagt ttttatttca tcaatattta taggtggttt ttcagtattg
    10621 tattcaaact ttttagataa atcactttga tatgtggatc cgtcattcat tgttattttc
    10681 caataaccac ccgttttatc gcttgaacga tataatccat gtatttgagt tagctgatga
    10741 cgaatttcaa agtctaaagt tgatatagct aattgttttt tatcgaactt tggccaatac
    10801 tttaaggggc tatctttacc atgaacctta acttttaaag gtagttctat tggagtaggt
    10861 aatttttcag tatttgtaac gccacttatt tggaaatgga tataagttcc ttcgctagta
    10921 tgttggcttt ttttagttct ttttgtgttt aagtcaactt tttccccttt tgtaaaagca
    10981 gggctataat aaggactcgg aaaaattata aggctgatgc tgccatctgt gttttttata
    11041 cgcatagatc ctaaggaatt atctaaaact tcactatttg taaaagtgtc agacccacta
    11101 ctataccagt ctagcaaatc ctttatatta tcgtttgtag atgcttttgc agttttgatt
    11161 atttgattag atgataaggg aacaggggta aaatctgtag cgattgtcgc aagcaacaaa
    11221 gggcttacga taaaaaaatt cattagtaat tttttattca tttttaattc tccttcattc
    11281 aaatgtgtaa acgtttacat atagaatgta taaatattat ttaaatgaat caattaacca
    11341 tctctaaatt attgtttaaa tatatattaa ttaaaaagtg tttgttacat agggagctat
    11401 atcaaaaaaa tatagattta aacaaaattt taaagttaca aatagcaaaa aacaaagtgt
    11461 gagtggtcat ttaaagaata ttaattaata taagtttgaa ttagttatat tctttaaagt
    11521 cactttctag tggcgttttt tacgctgaga aacgtcctgt gttgcagtaa gggataatat
    11581 tgtgtaacta gatatgttta tcgtaaatgt ggatccgtga aatatgactt taaacatcgc
    11641 tggtcaatct atctttgaga ttggccgtag attaaaacca tatgaaacaa aatgacttag
    11701 tggatgggga atttaggcta tggcttgaaa attggattaa gcaaattatc agataataga
    11761 tttatgaaaa tagctgaaaa tccagaatta aatgtcctac cattggaata tatgggcgca
    11821 tgtattttat actaattagc aacattaccg caagaagaga aaggataaga gtatttcact
    11881 aaaggtgaga agtaaaaaaa caattgatat gactaggaga gaattagaat accttaaaaa
    11941 ggaattgaaa caacgcgatg aaaaaacgcc caactccaat cacaaatgaa aaagcacaac
    12001 tttttgagga gatagagaga aagtaattaa aggaagttaa aggtaaagaa tctgaagtaa
    12061 ttgagtgtta catagatcca gaagattatc actgttcaaa agaaaagagg caggagtaat
    12121 ctgcctctcg aaaaaagtta ttttttagtg atttgaattt catttatatc tttaggattg
    12181 atgtatctat tgcttacgtt tgatttatct tctcctactt taccgaatac agtctcatct
    12241 ttagggtctg tacttaagat tgaaacattg tcgccgttgt tcactatatt tttttctttc
    12301 aatttttctg ttaatttttt ccatgtatta ttagcatcaa tattaggata gttcgaattt
    12361 tttctagtta tattaatttt tgtaacattt tgagggttta ttttaggatt gtttgaagta
    12421 ctaatatttt ctaaattagc tgttccttct atggtatttt ctccaccatt ttctatttta
    12481 tacgtaacct tgacattttc attatctgtt ttatcgataa tattcgcgtc ttttaaagcg
    12541 tctcttacat ttttccacaa tgcgttatct gtcgtttgct cagcttttgc aacgttatta
    12601 ataccattat aatttgaaga agaatgaaaa cctgaaccta ctgttgttaa aactaaagca
    12661 cttgctatca atgtttttgt taatagtttt ttattcattt tattttctcc tataacttat
    12721 ttgcaatcaa ttacaaagta attttacaat tattatttat gtaaatcaat taaataatta
    12781 ttaacaaatc cataaaattt tatcattaaa atataataat tttgagctag aagtattcgt
    12841 catttatgct ataatcattt tagacacagc aatgtgttca aattttcatc tattcgtaag
    12901 ttagccttcg ggctgacttt ttatttccat tattattcac atgttaatct tgttgatatt
    12961 taggcaagta cttcggtact tgcctattat tatatctcta tacgatagga atcgactata
    13021 tgacttacta agttttatag caaaataggc aattaacgca tatggcattt aacattgagt
    13081 tgttatagta gttgtataat atatagctag ttccttataa cagcaaaaaa ataattttga
    13141 ctataagatt aaatatatga atataaaatt aacagtagaa accaatttta gaatttgcaa
    13201 aaatgaatgc attaattata aaagtgtgaa tatataaaca atgttattaa ttcaagatgc
    13261 ttagaaatcc tctgtttttc ctagagaaag agttttgtat ataagttcaa atgaaatata
    13321 gttaattaat tttcaaagca taacttaatt cctataaata aagagaaatc attaaatata
    13381 attaattttc ttttaatatt tttttaattg aatatttaag aatataacat atatttaaag
    13441 tgtatctaga tactttttgg gaatgttgga taaaggagat aaaaaatgta taagagatta
    13501 tttatttcac gtgtaatttt gatattcgca ctgatactag ttatttctac acccaacgtt
    13561 ttagcagaga gtcaaccaga ccctatgcca gatgatttgc acaaatcaag tgagtttact
    13621 ggtacgatgg gtaatatgaa atatttatat gatgatcatt atgtatcagc aactaaagtt
    13681 aagtctgtag ataaattttt ggcacatgat ttaatttata acattagtga taaaaaactg
    13741 aaaaattatg acaaagtgaa aacagagtta ttaaatgaag atttagcaaa gaagtacaaa
    13801 gatgaagtag ttgatgtgta tggatcaaat tactatgtaa actgctattt ttcatccaaa
    13861 gataatgtag gtaaagttac aggtggtaaa acttgtatgt atggaggaat aacaaaacat
    13921 gaaggaaacc actttgataa tgggaactta caaaatgtac ttgtaagagt ttatgaaaat
    13981 aaaagaaaca caatttcttt tgaagtgcaa actgataaga aaagtgtaac agctcaagaa
    14041 ctagacataa aagctaggaa ttttttaatt aataaaaaaa atttgtatga gtttaacagt
    14101 tcaccatatg aaacaggata tataaaattt attgaaaata acggcaatac tttttggtat
    14161 gatatgatgc ctgcaccagg cgataagttt gaccaatcta aatatttaat gatgtacaac
    14221 gacaataaaa cggttgattc taaaagtgtg aagatagaag tccaccttac aacaaagaat
    14281 ggataatgtt aatccgattt tgatataaaa agtgaaagta ttagatatat ttgaaaggta
    14341 agtacttcgg tgcttgcctt tttaggatgc atatatatag attaaaccgc acttctatat
    14401 taatagaaag tgcggttatt tatacagtgt aatctaaact ataataattg gaatcatctt
    14461 tttgaaattt cgacatctag atgaaattgt gttgaatcaa cagttttatt atctttgtaa
    14521 atttttaaga agctttctgg aagaccgtat cctgtgtaaa ataaatcata cgagaaatta
    14581 gaaccatcat tcatatggaa tactacactc cccttatcaa aaccgctata aaattttgaa
    14641 gaagtgccgt attctttacc tttaccagta tcattgtgtc cataaatatt aaattcatct
    14701 tgcaagtatt ttcttagttt gacatctatt tcttgtgcgg taaccatttt tttatctgta
    14761 gaaacacttt tagttgtaac tgtttgatgc ttgccattga taattaaatt tataggtatt
    14821 attcttggcg aatctaattt attgttttct gctttagtaa caccaccata tatagtacga
    14881 gagttagaac catatttata gcttatacca aaaacatcga cattttttcc ctttagatca
    14941 ttagttatat attcattgtc aaattcagca tacaatgtat catttttata cgagtattct
    15001 aagcggtgtg attctggtga atttttgtct ttaacattct ttaaattcac atattcatat
    15061 ttagtataaa aatttcttag gtttcctgga cctacatcgc cgttagataa ggctgtatga
    15121 ttagaagaaa aaataaataa agtaataaca attacaaata ataatctttt tttcatatta
    15181 ggcacttcct tttcattata tttataataa cattataaat ataagttgaa taataaattt
    15241 tagaaaattc ataaaaaata caaaaggtta taaaggaaga gttatagaaa aatatgtatc
    15301 atcccacacg ttgcaggcag tgaatacgta tttgaatacg ttaattatga ggtgatgttg
    15361 ggtgcacaaa tttatatagt tttatctccc gccgtctcca t
//