LOCUS KX358623 191 bp RNA linear VRL 12-JUN-2016 DEFINITION Zika virus isolate AF01 nonstructural protein 5 gene, partial cds. ACCESSION KX358623 VERSION KX358623.1 KEYWORDS . SOURCE Zika virus ORGANISM Zika virus Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes; Amarillovirales; Flaviviridae; Orthoflavivirus; Orthoflavivirus zikaense. REFERENCE 1 (bases 1 to 191) AUTHORS Perez,S. TITLE Confirmed case of Zika virus congenital infection in Spain JOURNAL Unpublished REFERENCE 2 (bases 1 to 191) AUTHORS Perez,S. TITLE Direct Submission JOURNAL Submitted (06-JUN-2016) Department of Microbiology, University Hospital of Vigo, Hospital Meixoeiro, Apartado Oficial s/n, Vigo, Pontevedra 36200, Spain COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..191 /organism="Zika virus" /mol_type="genomic RNA" /isolate="AF01" /isolation_source="amniotic fluid" /host="Homo sapiens; female" /db_xref="taxon:64320" /country="Venezuela" /collection_date="29-Mar-2016" /note="subtype: Asian Clade" CDS <1..>191 /note="NS5" /codon_start=2 /product="nonstructural protein 5" /protein_id="ANI87834.1" /translation="LGFLNEDHWMGRENSGGGVEGLGLQRLGYVLEEMSRIPGGRMYA DDTAGWDTRISRFDLENEA" BASE COUNT 53 a 33 c 65 g 40 t ORIGIN 1 ccttggattc ttgaacgagg atcactggat ggggagagag aactcaggag gtggtgttga 61 agggctggga ttacaaagac tcggatatgt cctagaagag atgagtcgca taccaggagg 121 aaggatgtat gcagatgaca ctgctggctg ggacacccgc atcagcaggt ttgatctgga 181 gaatgaagct c //