LOCUS JX289966 550 bp DNA linear VRL 15-SEP-2012 DEFINITION HIV-1 isolate UK1-BR-4 from United Kingdom nef protein (nef) gene, partial cds. ACCESSION JX289966 VERSION JX289966.1 KEYWORDS . SOURCE Human immunodeficiency virus 1 (HIV-1) ORGANISM Human immunodeficiency virus 1 Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus. REFERENCE 1 (bases 1 to 550) AUTHORS Gray,L., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C., Wesselingh,S., Gorry,P. and Churchill,M.J. TITLE Reduced basal transcriptional activity of central nervous system-derived HIV-1 long terminal repeats JOURNAL AIDS Res. Hum. Retroviruses (2012) In press PUBMED 22924643 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 550) AUTHORS Gray,L.R., Cowley,D., Crespan,E., Welsh,C., Mackenzie,C., Wesselingh,S.L., Gorry,P.R. and Churchill,M.J. TITLE Direct Submission JOURNAL Submitted (08-JUL-2012) Centre for Virology, Burnet Institute, 85 Commercial Road, Melbourne, Victoria 3004, Australia FEATURES Location/Qualifiers source 1..550 /organism="Human immunodeficiency virus 1" /proviral /mol_type="genomic DNA" /isolate="UK1-BR-4" /host="Homo sapiens" /db_xref="taxon:11676" /country="United Kingdom" repeat_region <1..>550 /note="3' long terminal repeat" /rpt_type=long_terminal_repeat gene <1..332 /gene="nef" CDS <1..332 /gene="nef" /codon_start=3 /product="nef protein" /protein_id="AFR45948.1" /translation="EGLVYSQKRQDILDLWVYHTQGYFPDWQNYTPGPGTRYPLTFGW CFKLVPIDPDEVEKANEGENNKLLHPMSLHGMDDPEKEVLIWKFDSHLAFHHVARELH PEYYKDC" BASE COUNT 144 a 135 c 148 g 123 t ORIGIN 1 tggaagggct agtttactcc cagaaaagac aagacatcct tgatctgtgg gtctaccaca 61 cacaaggcta cttccctgat tggcagaact acacaccagg gccagggacc agatatccac 121 tgacctttgg atggtgcttc aagctagtac caattgaccc agacgaggta gaaaaggcca 181 atgaaggaga aaacaacaag ctgttacacc ctatgagcct gcatgggatg gatgacccag 241 agaaagaagt gttaatatgg aagtttgaca gccacctagc atttcatcac gtggcccgag 301 agctgcatcc ggagtactac aaggactgct gacatcgaac tttctacaag ggactttccg 361 ctggggactt tccaaggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat 421 gctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga tcagatctga 481 gcctgggagc tctctggcta gctagggaac ccactgctta agcctcaata aagcttgcct 541 tgagtgcttc //