LOCUS       FM210555                 446 bp    DNA     linear   VRL 24-NOV-2009
DEFINITION  Human Adenovirus 47 fibershaft.
ACCESSION   FM210555
VERSION     FM210555.1
KEYWORDS    .
SOURCE      Human adenovirus 47
  ORGANISM  Human adenovirus 47
            Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D.
REFERENCE   1  (bases 1 to 446)
  AUTHORS   Darr S.
  JOURNAL   Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of
            Virology, Hannover Medical School, Carl-Neuberg-Strasse 1,
            Hannover, 30625, GERMANY.
REFERENCE   2
  AUTHORS   Darr S., Madisch I., Hofmayer S., Rehren F., Heim A.
  TITLE     Phylogeny and primary structure analysis of fiber shafts of all
            human adenovirus types for rational design of adenoviral
            gene-therapy vectors
  JOURNAL   J. Gen. Virol. 90(Pt 12), 2849-2854(2009).
   PUBMED   19656960
FEATURES             Location/Qualifiers
     source          1..446
                     /organism="Human adenovirus 47"
                     /lab_host="A549 Human lung carcinoma cell line"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46942"
     CDS             <1..>446
                     /codon_start=1
                     /gene="fibershaft"
                     /product="fiber protein"
                     /db_xref="GOA:C8Z278"
                     /db_xref="InterPro:IPR000931"
                     /db_xref="InterPro:IPR000939"
                     /db_xref="InterPro:IPR009013"
                     /db_xref="UniProtKB/TrEMBL:C8Z278"
                     /protein_id="CAR66131.1"
                     /translation="GVLSLKLADPIAITNGDVSLKVGGGLTVEQDSGNLKVNTKAPLQ
                     VAADKQLEIALADPFEVSKGRLGIKAGHGLKVIDNSISGLEGLVGTLVVLTGHGIGTE
                     NLLNNDGSSRGVGINVRLGKDGGLSFDKKGDLVAWNKKYDTRTLWTT"
BASE COUNT          141 a           74 c          117 g          114 t
ORIGIN      
        1 ggggtcctgt cactcaaact ggctgaccca atcgctatca ccaatggaga tgtctcactc
       61 aaggtgggag ggggactgac tgtggaacaa gatagtggaa acctaaaggt gaacactaaa
      121 gctcccttgc aagttgcagc tgataaacaa ttggaaattg cactggctga tccatttgaa
      181 gtcagtaaag gcaggcttgg tataaaagca ggtcatggat tgaaagtcat tgacaattca
      241 atttctggtt tagaaggctt ggtaggcacg cttgtagttt tgactggtca tggaattggc
      301 actgaaaact tgcttaacaa tgatggatcg agcagaggag ttggaataaa cgtaagactt
      361 ggaaaagatg gaggtttatc ctttgataaa aagggtgatt tagtagcatg gaataaaaaa
      421 tatgatactc gcaccctttg gacaac
//