LOCUS FM210555 446 bp DNA linear VRL 24-NOV-2009 DEFINITION Human Adenovirus 47 fibershaft. ACCESSION FM210555 VERSION FM210555.1 KEYWORDS . SOURCE Human adenovirus 47 ORGANISM Human adenovirus 47 Viruses; Adenoviridae; Mastadenovirus; Human mastadenovirus D. REFERENCE 1 (bases 1 to 446) AUTHORS Darr S. JOURNAL Submitted (10-SEP-2008) to the INSDC. Darr S., Institute of Virology, Hannover Medical School, Carl-Neuberg-Strasse 1, Hannover, 30625, GERMANY. REFERENCE 2 AUTHORS Darr S., Madisch I., Hofmayer S., Rehren F., Heim A. TITLE Phylogeny and primary structure analysis of fiber shafts of all human adenovirus types for rational design of adenoviral gene-therapy vectors JOURNAL J. Gen. Virol. 90(Pt 12), 2849-2854(2009). PUBMED 19656960 FEATURES Location/Qualifiers source 1..446 /organism="Human adenovirus 47" /lab_host="A549 Human lung carcinoma cell line" /mol_type="genomic DNA" /db_xref="taxon:46942" CDS <1..>446 /codon_start=1 /gene="fibershaft" /product="fiber protein" /db_xref="GOA:C8Z278" /db_xref="InterPro:IPR000931" /db_xref="InterPro:IPR000939" /db_xref="InterPro:IPR009013" /db_xref="UniProtKB/TrEMBL:C8Z278" /protein_id="CAR66131.1" /translation="GVLSLKLADPIAITNGDVSLKVGGGLTVEQDSGNLKVNTKAPLQ VAADKQLEIALADPFEVSKGRLGIKAGHGLKVIDNSISGLEGLVGTLVVLTGHGIGTE NLLNNDGSSRGVGINVRLGKDGGLSFDKKGDLVAWNKKYDTRTLWTT" BASE COUNT 141 a 74 c 117 g 114 t ORIGIN 1 ggggtcctgt cactcaaact ggctgaccca atcgctatca ccaatggaga tgtctcactc 61 aaggtgggag ggggactgac tgtggaacaa gatagtggaa acctaaaggt gaacactaaa 121 gctcccttgc aagttgcagc tgataaacaa ttggaaattg cactggctga tccatttgaa 181 gtcagtaaag gcaggcttgg tataaaagca ggtcatggat tgaaagtcat tgacaattca 241 atttctggtt tagaaggctt ggtaggcacg cttgtagttt tgactggtca tggaattggc 301 actgaaaact tgcttaacaa tgatggatcg agcagaggag ttggaataaa cgtaagactt 361 ggaaaagatg gaggtttatc ctttgataaa aagggtgatt tagtagcatg gaataaaaaa 421 tatgatactc gcaccctttg gacaac //