LOCUS EU047749 192 bp mRNA linear INV 28-JUN-2010 DEFINITION Bombyx mori cecropin B mRNA, complete cds. ACCESSION EU047749 VERSION EU047749.1 KEYWORDS . SOURCE Bombyx mori (domestic silkworm) ORGANISM Bombyx mori Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea; Bombycidae; Bombycinae; Bombyx. REFERENCE 1 (bases 1 to 192) AUTHORS George,J., Sanath,K., Karunasagar,I. and Karunasagar,I. TITLE cDNA cloning and expression of antimicrobial peptide cecropin B from Bombyx mori JOURNAL Unpublished REFERENCE 2 (bases 1 to 192) AUTHORS George,J., Sanath,K., Karunasagar,I. and Karunasagar,I. TITLE Direct Submission JOURNAL Submitted (21-JUL-2007) Microbiology, College of Fisheries, Karnataka Veterinary Animal and Fisheries Sciences University, Mangalore, Karnataka 575002, India FEATURES Location/Qualifiers source 1..192 /organism="Bombyx mori" /mol_type="mRNA" /db_xref="taxon:7091" /country="India" CDS 1..192 /note="antibacterial peptide" /codon_start=1 /product="cecropin B" /protein_id="ABU23728.1" /translation="MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDG IVKAGPAIEVLGSAKAIGK" BASE COUNT 51 a 47 c 52 g 42 t ORIGIN 1 atgaatttcg caaagatcct atccttcgtc ttcgctctgg tgctggcttt gagcatgacc 61 agtgctgctc ccgagcccag gtggaagatc ttcaagaaaa ttgaaaaaat gggcaggaac 121 atccgtgacg gcatcgtcaa agcgggcccg gcgatcgagg tcctcggttc agctaaagcc 181 ataggaaaat ga //