LOCUS       EU047749                 192 bp    mRNA    linear   INV 28-JUN-2010
DEFINITION  Bombyx mori cecropin B mRNA, complete cds.
ACCESSION   EU047749
VERSION     EU047749.1
KEYWORDS    .
SOURCE      Bombyx mori (domestic silkworm)
  ORGANISM  Bombyx mori
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata;
            Ditrysia; Bombycoidea; Bombycidae; Bombycinae; Bombyx.
REFERENCE   1  (bases 1 to 192)
  AUTHORS   George,J., Sanath,K., Karunasagar,I. and Karunasagar,I.
  TITLE     cDNA cloning and expression of antimicrobial peptide cecropin B
            from Bombyx mori
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 192)
  AUTHORS   George,J., Sanath,K., Karunasagar,I. and Karunasagar,I.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUL-2007) Microbiology, College of Fisheries,
            Karnataka Veterinary Animal and Fisheries Sciences University,
            Mangalore, Karnataka 575002, India
FEATURES             Location/Qualifiers
     source          1..192
                     /organism="Bombyx mori"
                     /mol_type="mRNA"
                     /db_xref="taxon:7091"
                     /country="India"
     CDS             1..192
                     /note="antibacterial peptide"
                     /codon_start=1
                     /product="cecropin B"
                     /protein_id="ABU23728.1"
                     /translation="MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDG
                     IVKAGPAIEVLGSAKAIGK"
BASE COUNT           51 a           47 c           52 g           42 t
ORIGIN      
        1 atgaatttcg caaagatcct atccttcgtc ttcgctctgg tgctggcttt gagcatgacc
       61 agtgctgctc ccgagcccag gtggaagatc ttcaagaaaa ttgaaaaaat gggcaggaac
      121 atccgtgacg gcatcgtcaa agcgggcccg gcgatcgagg tcctcggttc agctaaagcc
      181 ataggaaaat ga
//