LOCUS CT010368 633 bp mRNA linear ROD 24-SEP-2008 DEFINITION Mus musculus full open reading frame cDNA clone RZPDo836C0153D for gene Cd7, CD7 antigen; complete cds, incl. stopcodon. ACCESSION CT010368 VERSION CT010368.1 KEYWORDS Full ORF clone, Expression Shuttle System, Gateway(R), complete cds. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 633) AUTHORS Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B. TITLE Cloning of mouse full open reading frames in Gateway(R) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 633) AUTHORS Ebert L., Muenstermann E., Schatten R., Henze S., Bohn E., Mollenhauer J., Wiemann S., Schick M., Korn B. JOURNAL Submitted (20-JUL-2005) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 515, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo836C0153D, ORFNo 30402 http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo836C0153D Mouse Full ORF Gateway(R) Clones - RZPD (kan-resist.) RZPDLIB No. 836 http://www.rzpd.de/cgi-bin/products/showLib.pl.cgi/ response?libNo=836 http://www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 http://www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of mouse full ORF clones jointly established and verified by DKFZ (www.dkfz.de) and RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The stopcodon is followed by the 3' att site: GACCCAGCTTTCTTGTAC..att The clone is validated by full sequence check. Compared to the reference sequence BC024376 (GI:19353421) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..633 /organism="Mus musculus" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Mouse Full ORF Gateway(R) Clones - RZPD" /clone="RZPDo836C0153D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:10090" CDS 1..633 /codon_start=1 /gene="Cd7" /db_xref="GOA:Q8R1M4" /db_xref="InterPro:IPR003599" /db_xref="InterPro:IPR007110" /db_xref="InterPro:IPR013106" /db_xref="InterPro:IPR013783" /db_xref="InterPro:IPR036179" /db_xref="InterPro:IPR039090" /db_xref="MGI:MGI:88344" /db_xref="UniProtKB/TrEMBL:Q8R1M4" /protein_id="CAJ18575.1" /translation="MTQQAVLALLLTLAGILPGPLDAQDVHQSPRVVIASEGDSVNIT CSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQ LADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFPAAIAVGFFFT GLLLGVVCSMLRKIQIKKLCASGIKDSPCVVYEDMSYSNRKTPCIPNQYQ" BASE COUNT 156 a 179 c 159 g 139 t ORIGIN 1 atgactcagc aggcagtgct ggctttgctg cttacactgg ccggaatcct gcctggcccc 61 ctggatgccc aagacgtaca ccagtccccc cgagtcgtga ttgcctctga gggggattcc 121 gtcaacatca cctgctctac aagagggcac ctggaaggga tcttaatgaa gaagatctgg 181 cctcaggctt acaatgtgat ttactttgaa gaccggcagg agcccacagt agacaggacc 241 ttctcaggcc gaattaattt ctctggttcc cagaagaacc tgaccatcac cataagctcc 301 ctccagctgg cagacactgg agactacacc tgcgaggctg tcaggaaagt cagtgcccgt 361 ggcttgttca ccacggttgt ggtgaaagaa aaatcatccc aagaagcata cagatcccag 421 gaacctctgc agacatcatt ttccttccca gctgccattg ctgtaggctt cttcttcacc 481 gggctgctcc ttggggtggt gtgcagcatg ctgaggaaga tacagatcaa gaaactgtgt 541 gcctcaggga ttaaggactc tccgtgcgta gtgtatgaag acatgtccta cagcaaccgc 601 aagacgccat gcatccccaa ccagtaccag tag //