LOCUS       CR536490                1098 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834C0420D for
            gene MAPK13, mitogen-activated protein kinase 13; complete cds,
            incl. stopcodon.
ACCESSION   CR536490
VERSION     CR536490.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1098)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 1098)
  AUTHORS   Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
            Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
            Korn B., Zuo D., Hu Y., LaBaer J.
  JOURNAL   Submitted (23-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834C0420D, ORFNo 3037
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834C0420D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is a part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics and RZPD.
            This CDS has been cloned incl. stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The stopcodon is followed by the 3' att site:
            (stop)GACCCAGCTTTCTT..att
            Compared to the reference sequence NM_002754 (gi20986527)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..1098
                     /db_xref="H-InvDB:HIT000268428"
                     /organism="Homo sapiens"
                     /lab_host="DH10B"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834C0420D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..1098
                     /codon_start=1
                     /gene="MAPK13"
                     /db_xref="GOA:O15264"
                     /db_xref="H-InvDB:HIT000268428.13"
                     /db_xref="HGNC:HGNC:6875"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008352"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR038785"
                     /db_xref="PDB:3COI"
                     /db_xref="PDB:4EYJ"
                     /db_xref="PDB:4EYM"
                     /db_xref="PDB:4MYG"
                     /db_xref="PDB:4YNO"
                     /db_xref="PDB:5EKN"
                     /db_xref="PDB:5EKO"
                     /db_xref="UniProtKB/Swiss-Prot:O15264"
                     /protein_id="CAG38729.1"
                     /translation="MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAID
                     KRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYD
                     FYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNE
                     DCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLT
                     GKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPR
                     ASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLT
                     VDEWKQHIYKEIVNFSPIARKDSRRRSGMKL"
BASE COUNT          260 a          310 c          324 g          204 t
ORIGIN      
        1 atgagcctca tccggaaaaa gggcttctac aagcaggacg tcaacaagac cgcctgggag
       61 ctgcccaaga cctacgtgtc cccgacgcac gtcggcagcg gggcctatgg ctccgtgtgc
      121 tcggccatcg acaagcggtc aggggagaag gtggccatca agaagctgag ccgacccttt
      181 cagtccgaga tcttcgccaa gcgcgcctac cgggagctgc tgctgctgaa gcacatgcag
      241 catgagaacg tcattgggct cctggatgtc ttcaccccag cctcctccct gcgcaacttc
      301 tatgacttct acctggtgat gcccttcatg cagacggatc tgcagaagat catggggatg
      361 gagttcagtg aggagaagat ccagtacctg gtgtatcaga tgctcaaagg ccttaagtac
      421 atccactctg ctggggtcgt gcacagggac ctgaagccag gcaacctggc tgtgaatgag
      481 gactgtgaac tgaagattct ggattttggg ctggcgcgac atgcagacgc cgagatgact
      541 ggctacgtgg tgacccgctg gtaccgagcc cccgaggtga tcctcagctg gatgcactac
      601 aaccagacag tggacatctg gtctgtgggc tgtatcatgg cagagatgct gacagggaaa
      661 actctgttca aggggaaaga ttacctggac cagctgaccc agatcctgaa agtgaccggg
      721 gtgcctggca cggagtttgt gcagaagctg aacgacaaag cggccaaatc ctacatccag
      781 tccctgccac agacccccag gaaggatttc actcagctgt tcccacgggc cagcccccag
      841 gctgcggacc tgctggagaa gatgctggag ctagacgtgg acaagcgcct gacggccgcg
      901 caggccctca cccatccctt ctttgaaccc ttccgggacc ctgaggaaga gacggaggcc
      961 cagcagccgt ttgatgattc cttagaacac gagaaactca cagtggatga atggaagcag
     1021 cacatctaca aggagattgt gaacttcagc cccattgccc ggaaggactc acggcgccgg
     1081 agtggcatga agctgtag
//