LOCUS CR457279 993 bp mRNA linear HUM 17-APR-2005 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834A0813D for gene WDR5B, WD repeat domain 5B; complete cds, incl. stopcodon. ACCESSION CR457279 VERSION CR457279.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 993) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 993) AUTHORS Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. JOURNAL Submitted (03-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834A0813D, ORFNo 2272 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834A0813D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is a part of a collection of human full length expression clones generated by RZPD. This CDS has been cloned incl. stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC (ATG). The last base of the last coding triplett has been changed to T, which might lead to an amino acid change at the C terminus of the polypeptide. The stop codon has been set to TAA followed by TTAACCCAGCTTTCTT..att. Compared to the reference sequence NM_019069 we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..993 /db_xref="H-InvDB:HIT000268129" /organism="Homo sapiens" /lab_host="DH10B" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834A0813D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..993 /codon_start=1 /gene="WDR5B" /db_xref="GOA:Q86VZ2" /db_xref="H-InvDB:HIT000268129.14" /db_xref="HGNC:HGNC:17826" /db_xref="InterPro:IPR001680" /db_xref="InterPro:IPR015943" /db_xref="InterPro:IPR017986" /db_xref="InterPro:IPR019775" /db_xref="InterPro:IPR020472" /db_xref="InterPro:IPR036322" /db_xref="InterPro:IPR037866" /db_xref="UniProtKB/Swiss-Prot:Q86VZ2" /protein_id="CAG33560.1" /translation="MATKESRDAKAQLALSSSANQSKEVPENPNYALKCTLVGHTEAV SSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSSRLVSAS DDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCL KTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKF SPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED NLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLWMSNH" BASE COUNT 302 a 187 c 217 g 287 t ORIGIN 1 atggcaacca aggagtcaag agacgccaaa gcacagttgg ccctctcctc atcggccaat 61 cagagcaagg aagtgcctga aaacccaaac tatgctctca aatgtactct tgtgggacac 121 acggaagcag tgtcatcagt taagtttagt cctaatggag aatggctagc aagttcttct 181 gctgataggc taatcataat ttggggagca tatgatggaa aatatgagaa aacactctat 241 ggtcataatt tggaaatatc ggatgttgcc tggtcatcag attccagtcg tcttgtttct 301 gcctcagatg ataaaactct aaaattatgg gatgtgagat ctggaaaatg tttgaaaaca 361 ctgaaggggc acagtaatta tgtcttttgt tgtaacttca atccgccatc caaccttata 421 atctcgggat cttttgatga gactgtaaaa atatgggagg tgaaaacagg aaagtgtctc 481 aagactttgt ctgctcattc tgacccagtt tctgctgttc attttaattg tagtgggtcc 541 ttgatagtgt caggtagcta tgatggcctc tgtagaatct gggatgctgc atcaggtcag 601 tgtttaaaaa cgctcgttga tgacgataac cctcctgtct cttttgtaaa attttctcca 661 aatggtaaat acattctcac tgcaactttg gacaacactc ttaaactatg ggattatagc 721 agaggcaggt gcctgaaaac atacactggt cataagaatg agaaatattg catatttgcc 781 aatttttcag ttactggtgg aaagtggatt gtgtctggtt ccgaggataa cctggtttac 841 atttggaacc ttcagactaa agagattgtg cagaaattac aaggccatac agatgttgtg 901 atctcagcag cttgtcatcc tacagaaaac ctcatcgcat cagcagcatt agaaaatgac 961 aaaacaatta aactgtggat gagtaaccat taa //