LOCUS BT009849 321 bp mRNA linear HUM 02-AUG-2003 DEFINITION Homo sapiens ATPase inhibitory factor 1 mRNA, complete cds. ACCESSION BT009849 VERSION BT009849.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 321) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA REFERENCE 2 (bases 1 to 321) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..321 /db_xref="H-InvDB:HIT000266411" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH01063X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..321 /codon_start=1 /product="ATPase inhibitory factor 1" /protein_id="AAP88851.1" /translation="MAVTALAARTWLGVWGVRTMQARGFGSDQSENVDRGAGSIREAG GAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKML KHDD" BASE COUNT 95 a 65 c 108 g 53 t ORIGIN 1 atggcagtga cggcgttggc ggcgcggacg tggcttggcg tgtggggcgt gaggaccatg 61 caagcccgag gcttcggctc ggatcagtcc gagaatgtcg accggggcgc gggctccatc 121 cgggaagccg gtggggcctt cggaaagaga gagcaggctg aagaggaacg atatttccga 181 gcacagagta gagaacaact ggcagctttg aaaaaacacc atgaagaaga aatcgttcat 241 cataagaagg agattgagcg tctgcagaaa gaaattgagc gccataagca gaagatcaaa 301 atgctaaaac atgatgatta g //