LOCUS       BT009849                 321 bp    mRNA    linear   HUM 02-AUG-2003
DEFINITION  Homo sapiens ATPase inhibitory factor 1 mRNA, complete cds.
ACCESSION   BT009849
VERSION     BT009849.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 321)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-JUL-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
REFERENCE   2  (bases 1 to 321)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2003) BD Biosciences Clontech, 1020 East Meadow
            circle, Palo Alto, California 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..321
                     /db_xref="H-InvDB:HIT000266411"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH01063X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..321
                     /codon_start=1
                     /product="ATPase inhibitory factor 1"
                     /protein_id="AAP88851.1"
                     /translation="MAVTALAARTWLGVWGVRTMQARGFGSDQSENVDRGAGSIREAG
                     GAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKML
                     KHDD"
BASE COUNT           95 a           65 c          108 g           53 t
ORIGIN      
        1 atggcagtga cggcgttggc ggcgcggacg tggcttggcg tgtggggcgt gaggaccatg
       61 caagcccgag gcttcggctc ggatcagtcc gagaatgtcg accggggcgc gggctccatc
      121 cgggaagccg gtggggcctt cggaaagaga gagcaggctg aagaggaacg atatttccga
      181 gcacagagta gagaacaact ggcagctttg aaaaaacacc atgaagaaga aatcgttcat
      241 cataagaagg agattgagcg tctgcagaaa gaaattgagc gccataagca gaagatcaaa
      301 atgctaaaac atgatgatta g
//