LOCUS BT007049 861 bp mRNA linear HUM 13-MAY-2003 DEFINITION Homo sapiens ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation) mRNA, complete cds. ACCESSION BT007049 VERSION BT007049.1 KEYWORDS FLI_CDNA. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 861) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Cloning of human full-length CDSs in BD Creator(TM) System Donor vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 861) AUTHORS Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S., Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y., Phelan,M. and Farmer,A. TITLE Direct Submission JOURNAL Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA COMMENT This CDS clone is a part of a collection of human full length expression clones generated by BD Biosciences Clontech and the Harvard Institute of Proteomics. Each CDS has been cloned in two forms: with and without stop-codon (to allow fusion with C-terminal tag). The CDS has been directionally cloned using BD In-Fusion(TM) cloning system between the SalI and HindIII sites of the pDNR-DUAL vector. Additional sequences in the clone: 'ACC' after SalI site and before 'ATG' to provide Kozak consensus sequence; 'GG' after last codon and before HindIII site to maintain reading frame. Clone distribution: http://bioinfo.clontech.com/orfclones. FEATURES Location/Qualifiers source 1..861 /db_xref="H-InvDB:HIT000099969" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="GH00300X1.0" /clone_lib="BD Creator(TM) CDS Library derived from MGC collection" /lab_host="DH5alpha T1 resistant" /note="Vector: pDNR-Dual" CDS 1..861 /codon_start=1 /product="ceroid-lipofuscinosis, neuronal 8 (epilepsy, progressive with mental retardation)" /protein_id="AAP35698.1" /translation="MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQ LSSSLNATYRSLVAREKVFWDLAATRAVFGVQSTAAGLWALLGDPVLHADKARGQQNW CWFHITTATGFFCFENVAVHLSNLIFRTFDLFLVIHHLFAFLGFLGCLVNLQAGHYLA MTTLLLEMSTPFTCVSWMLLKAGWSESLFWKLNQWLMIHMFHCRMVLTYHMWWVCFWH WDGLVSSLYLPHLTLFLVGLALLTLIINPYWTHKKTQQLLNPVDWNFAQPEAKSRPEG NGQLLRKKRP" BASE COUNT 159 a 232 c 235 g 235 t ORIGIN 1 atgaatcctg cgagcgatgg gggcacatca gagagcattt ttgacctgga ctatgcatcc 61 tgggggatcc gctccacgct gatggtcgct ggctttgtct tctacttggg cgtctttgtg 121 gtctgccacc agctgtcctc ttccctgaat gccacttacc gttctttggt ggccagagag 181 aaggtcttct gggacctggc ggccacgcgt gcagtctttg gtgttcagag cacagccgca 241 ggcctgtggg ctctgctggg ggaccctgtg ctgcatgccg acaaggcgcg tggccagcag 301 aactggtgct ggtttcacat cacgacagca acgggattct tttgctttga aaatgttgca 361 gtccacctgt ccaacttgat cttccggaca tttgacttgt ttctggttat ccaccatctc 421 tttgcctttc ttgggtttct tggctgcttg gtcaatctcc aagctggcca ctatctagct 481 atgaccacgt tgctcctgga gatgagcacg ccctttacct gcgtttcctg gatgctctta 541 aaggcgggct ggtccgagtc tctgttttgg aagctcaacc agtggctgat gattcacatg 601 tttcactgcc gcatggttct aacctaccac atgtggtggg tgtgtttctg gcactgggac 661 ggcctggtca gcagcctgta tctgcctcat ttgacactgt tccttgtcgg actggctctg 721 cttacgctaa tcattaatcc atattggacc cataagaaga ctcagcagct tctcaatccg 781 gtggactgga acttcgcaca gccagaagcc aagagcaggc cagaaggcaa cgggcagctg 841 ctgcggaaga agaggccata g //