LOCUS       BT007049                 861 bp    mRNA    linear   HUM 13-MAY-2003
DEFINITION  Homo sapiens ceroid-lipofuscinosis, neuronal 8 (epilepsy,
            progressive with mental retardation) mRNA, complete cds.
ACCESSION   BT007049
VERSION     BT007049.1
KEYWORDS    FLI_CDNA.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 861)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Cloning of human full-length CDSs in BD Creator(TM) System Donor
            vector
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 861)
  AUTHORS   Kalnine,N., Chen,X., Rolfs,A., Halleck,A., Hines,L., Eisenstein,S.,
            Koundinya,M., Raphael,J., Moreira,D., Kelley,T., LaBaer,J., Lin,Y.,
            Phelan,M. and Farmer,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAY-2003) BD Biosciences Clontech, 1020 East Meadow
            Circle, Palo Alto, CA 94303, USA
COMMENT     This CDS clone is a part of a collection of human full length
            expression clones generated by BD Biosciences Clontech and the
            Harvard Institute of Proteomics. Each CDS has been cloned in two
            forms: with and without stop-codon (to allow fusion with C-terminal
            tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
            cloning system between the SalI  and HindIII sites of the pDNR-DUAL
            vector. Additional sequences in the clone:  'ACC' after SalI site
            and before 'ATG' to provide Kozak consensus sequence; 'GG' after
            last codon and before HindIII site to maintain reading frame.
            Clone distribution: http://bioinfo.clontech.com/orfclones.
FEATURES             Location/Qualifiers
     source          1..861
                     /db_xref="H-InvDB:HIT000099969"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="GH00300X1.0"
                     /clone_lib="BD Creator(TM) CDS Library derived from MGC
                     collection"
                     /lab_host="DH5alpha T1 resistant"
                     /note="Vector: pDNR-Dual"
     CDS             1..861
                     /codon_start=1
                     /product="ceroid-lipofuscinosis, neuronal 8 (epilepsy,
                     progressive with mental retardation)"
                     /protein_id="AAP35698.1"
                     /translation="MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQ
                     LSSSLNATYRSLVAREKVFWDLAATRAVFGVQSTAAGLWALLGDPVLHADKARGQQNW
                     CWFHITTATGFFCFENVAVHLSNLIFRTFDLFLVIHHLFAFLGFLGCLVNLQAGHYLA
                     MTTLLLEMSTPFTCVSWMLLKAGWSESLFWKLNQWLMIHMFHCRMVLTYHMWWVCFWH
                     WDGLVSSLYLPHLTLFLVGLALLTLIINPYWTHKKTQQLLNPVDWNFAQPEAKSRPEG
                     NGQLLRKKRP"
BASE COUNT          159 a          232 c          235 g          235 t
ORIGIN      
        1 atgaatcctg cgagcgatgg gggcacatca gagagcattt ttgacctgga ctatgcatcc
       61 tgggggatcc gctccacgct gatggtcgct ggctttgtct tctacttggg cgtctttgtg
      121 gtctgccacc agctgtcctc ttccctgaat gccacttacc gttctttggt ggccagagag
      181 aaggtcttct gggacctggc ggccacgcgt gcagtctttg gtgttcagag cacagccgca
      241 ggcctgtggg ctctgctggg ggaccctgtg ctgcatgccg acaaggcgcg tggccagcag
      301 aactggtgct ggtttcacat cacgacagca acgggattct tttgctttga aaatgttgca
      361 gtccacctgt ccaacttgat cttccggaca tttgacttgt ttctggttat ccaccatctc
      421 tttgcctttc ttgggtttct tggctgcttg gtcaatctcc aagctggcca ctatctagct
      481 atgaccacgt tgctcctgga gatgagcacg ccctttacct gcgtttcctg gatgctctta
      541 aaggcgggct ggtccgagtc tctgttttgg aagctcaacc agtggctgat gattcacatg
      601 tttcactgcc gcatggttct aacctaccac atgtggtggg tgtgtttctg gcactgggac
      661 ggcctggtca gcagcctgta tctgcctcat ttgacactgt tccttgtcgg actggctctg
      721 cttacgctaa tcattaatcc atattggacc cataagaaga ctcagcagct tctcaatccg
      781 gtggactgga acttcgcaca gccagaagcc aagagcaggc cagaaggcaa cgggcagctg
      841 ctgcggaaga agaggccata g
//