LOCUS       BC139900                 749 bp    mRNA    linear   HUM 23-JUL-2007
DEFINITION  Homo sapiens ADAM metallopeptidase with thrombospondin type 1
            motif, 12, mRNA (cDNA clone IMAGE:40147204), complete cds.
ACCESSION   BC139900
VERSION     BC139900.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 749)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 749)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-APR-2007) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Novartis Institute for Biomedical Research
            cDNA Library Preparation: Novartis Institute for Biomedical
            Research
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 306 Row: b Column: 2
            This clone has the following problem: The cds is short compared to
            the longest cds in the locus.
FEATURES             Location/Qualifiers
     source          1..749
                     /db_xref="H-InvDB:HIT000391222"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:40147204"
                     /tissue_type="Donated clones,Novartis FGA collection"
                     /clone_lib="NIH_MGC_417"
                     /lab_host="DH5a"
                     /note="Vector: pCMV-SPORT6"
     gene            1..749
                     /gene="ADAMTS12"
                     /gene_synonym="PRO4389"
                     /db_xref="GeneID:81792"
                     /db_xref="HGNC:HGNC:14605"
                     /db_xref="MIM:606184"
     CDS             8..697
                     /gene="ADAMTS12"
                     /gene_synonym="PRO4389"
                     /codon_start=1
                     /product="ADAMTS12 protein"
                     /protein_id="AAI39901.1"
                     /db_xref="GeneID:81792"
                     /db_xref="HGNC:HGNC:14605"
                     /db_xref="MIM:606184"
                     /translation="MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEH
                     FIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDL
                     FFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSAC
                     HGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMS
                     SWVEESVLFFW"
BASE COUNT          199 a          173 c          190 g          187 t
ORIGIN      
        1 ctgaatcatg ccatgtgccc agaggagctg gcttgcaaac ctttccgtgg tggctcagct
       61 ccttaacttt ggggcgcttt gctatgggag acagcctcag ccaggcccgg ttcgcttccc
      121 ggacaggagg caagagcatt ttatcaaggg cctgccagaa taccacgtgg tgggtccagt
      181 ccgagtagat gccagtgggc attttttgtc atatggcttg cactatccca tcacgagcag
      241 caggaggaag agagatttgg atggctcaga ggactgggtg tactacagaa tttctcacga
      301 ggagaaggac ctgtttttta acttgacggt caatcaagga tttctttcca atagctacat
      361 catggagaag agatatggga acctctccca tgttaagatg atggcttcct ctgcccccct
      421 ctgccatctc agtggcacgg ttctacagca gggcaccaga gttgggacgg cagccctcag
      481 tgcctgccat ggactgactg gatttttcca actaccacat ggagactttt tcattgaacc
      541 cgtgaagaag catccactgg ttgagggagg gtaccacccg cacatcgttt acaggaggca
      601 gaaagttcca gaaaccaagg agccaacctg tggattaaag ggtattgtga ctcacatgtc
      661 ctcctgggtt gaagaatctg ttttgttctt ttggtagttt tattaaaaca tgacctattc
      721 ttaaaaaaaa aaaaaaaaaa aaaaaaaaa
//