LOCUS BC139900 749 bp mRNA linear HUM 23-JUL-2007 DEFINITION Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 12, mRNA (cDNA clone IMAGE:40147204), complete cds. ACCESSION BC139900 VERSION BC139900.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 749) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 749) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (21-APR-2007) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Novartis Institute for Biomedical Research cDNA Library Preparation: Novartis Institute for Biomedical Research cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAK Plate: 306 Row: b Column: 2 This clone has the following problem: The cds is short compared to the longest cds in the locus. FEATURES Location/Qualifiers source 1..749 /db_xref="H-InvDB:HIT000391222" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:40147204" /tissue_type="Donated clones,Novartis FGA collection" /clone_lib="NIH_MGC_417" /lab_host="DH5a" /note="Vector: pCMV-SPORT6" gene 1..749 /gene="ADAMTS12" /gene_synonym="PRO4389" /db_xref="GeneID:81792" /db_xref="HGNC:HGNC:14605" /db_xref="MIM:606184" CDS 8..697 /gene="ADAMTS12" /gene_synonym="PRO4389" /codon_start=1 /product="ADAMTS12 protein" /protein_id="AAI39901.1" /db_xref="GeneID:81792" /db_xref="HGNC:HGNC:14605" /db_xref="MIM:606184" /translation="MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEH FIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDL FFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSAC HGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMS SWVEESVLFFW" BASE COUNT 199 a 173 c 190 g 187 t ORIGIN 1 ctgaatcatg ccatgtgccc agaggagctg gcttgcaaac ctttccgtgg tggctcagct 61 ccttaacttt ggggcgcttt gctatgggag acagcctcag ccaggcccgg ttcgcttccc 121 ggacaggagg caagagcatt ttatcaaggg cctgccagaa taccacgtgg tgggtccagt 181 ccgagtagat gccagtgggc attttttgtc atatggcttg cactatccca tcacgagcag 241 caggaggaag agagatttgg atggctcaga ggactgggtg tactacagaa tttctcacga 301 ggagaaggac ctgtttttta acttgacggt caatcaagga tttctttcca atagctacat 361 catggagaag agatatggga acctctccca tgttaagatg atggcttcct ctgcccccct 421 ctgccatctc agtggcacgg ttctacagca gggcaccaga gttgggacgg cagccctcag 481 tgcctgccat ggactgactg gatttttcca actaccacat ggagactttt tcattgaacc 541 cgtgaagaag catccactgg ttgagggagg gtaccacccg cacatcgttt acaggaggca 601 gaaagttcca gaaaccaagg agccaacctg tggattaaag ggtattgtga ctcacatgtc 661 ctcctgggtt gaagaatctg ttttgttctt ttggtagttt tattaaaaca tgacctattc 721 ttaaaaaaaa aaaaaaaaaa aaaaaaaaa //