LOCUS BC064604 3298 bp mRNA linear HUM 06-JAN-2004
DEFINITION Homo sapiens zinc finger protein 1 homolog (mouse), mRNA (cDNA
clone IMAGE:5784831), partial cds.
ACCESSION BC064604
VERSION BC064604.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3298)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 3298)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (22-DEC-2003) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: ATCC
cDNA Library Preparation: Life Technologies, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: National Institutes of Health Intramural
Sequencing Center (NISC),
Gaithersburg, Maryland;
Web site: http://www.nisc.nih.gov/
Contact: nisc_mgc@nhgri.nih.gov
Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
Young,A., Zhang,L.-H. and Green,E.D.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAK Plate: 139 Row: p Column: 13
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 24233531.
FEATURES Location/Qualifiers
source 1..3298
/db_xref="H-InvDB:HIT000261523"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:5784831"
/tissue_type="Uterus, leiomyosarcoma"
/clone_lib="NIH_MGC_71"
/lab_host="DH10B"
/note="Vector: pCMV-SPORT6"
gene <1..3298
/gene="ZFP1"
/gene_synonym="FLJ34243"
/gene_synonym="ZNF475"
/db_xref="GeneID:162239"
CDS <1..1348
/gene="ZFP1"
/gene_synonym="FLJ34243"
/gene_synonym="ZNF475"
/codon_start=2
/product="ZFP1 protein"
/protein_id="AAH64604.1"
/db_xref="GeneID:162239"
/translation="AALRRDPLWHWATSGGCAPPGTRGASSSAFIVLCLCPKLQKMNK
SQGSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQMERDHR
NPDEQARQFLILKNQTPIEERGDLFGKALNLNTDFVSLRQVPYKYDLYEKTLKYNSDL
LNSNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKI
KNLVQPFICTYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANLIKHQRIHT
GEKPFECPECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTHQRIHTGE
RPYECNECAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTGEKP
YECTECGKTFSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLSVHQRVHIGEKP"
misc_feature 146..268
/gene="ZFP1"
/gene_synonym="FLJ34243"
/gene_synonym="ZNF475"
/note="KRAB; Region: KRAB box. The KRAB domain (or
Kruppel-associated box) is present in about a third of
zinc finger proteins containing C2H2 fingers. The KRAB
domain is found to be involved in protein-protein
interactions. The KRAB domain is generally encoded by two
exons. The regions coded by the two exons are known as
KRAB-A and KRAB-B"
/db_xref="CDD:pfam01352"
misc_feature 758..826
/gene="ZFP1"
/gene_synonym="FLJ34243"
/gene_synonym="ZNF475"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 842..910
/gene="ZFP1"
/gene_synonym="FLJ34243"
/gene_synonym="ZNF475"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 1094..1162
/gene="ZFP1"
/gene_synonym="FLJ34243"
/gene_synonym="ZNF475"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 1178..1246
/gene="ZFP1"
/gene_synonym="FLJ34243"
/gene_synonym="ZNF475"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
BASE COUNT 1104 a 629 c 628 g 937 t
ORIGIN
1 cgccgccctg cgccgtgacc cgctgtggca ctgggccacg agtggaggct gcgcccctcc
61 aggtacgaga ggggcttcca gttctgcctt catagttctc tgcctttgcc caaaactgca
121 gaaaatgaac aaatcccagg gatcagtttc attcacggat gtgactgtgg actttaccca
181 ggaggaatgg gaacaactgg acccctctca gaggatccta tacatggatg tgatgctgga
241 gaattatagc aacttacttt cagtggaagt gtggaaggct gatgaccaga tggagagaga
301 ccacagaaac ccagacgagc aggcgaggca atttttaatt cttaagaacc aaaccccaat
361 tgaggaaaga ggcgatctct ttggaaaagc acttaatctg aacacagact ttgtttcttt
421 aagacaagta ccttataaat atgacttata tgaaaaaact ttgaaatata attcagactt
481 gcttaatagt aatagaagct atgcaggaaa gcagactgat gagtgtaatg aatttggaaa
541 agcacttctc tacctgaagc aagagaaaac ccacagtgga gtagaatatt ctgaatacaa
601 taaaagtgga aaagccctca gccataaagc agccattttt aaacatcaga aaataaaaaa
661 cttggttcaa cctttcattt gtacttactg tgacaaggct ttctccttta agtcactcct
721 cattagtcat aagagaatac atactggaga aaagccatat gaatgcaatg tatgtaagaa
781 aaccttctcc cataaggcca acctcatcaa acatcagaga attcacactg gggagaaacc
841 tttcgagtgt ccggaatgtg gaaaagcttt cacccaccag tcaaacctca ttgtacacca
901 gagagcacat atggagaaga agccctatga gtgcagtgaa tgtggaaaga catttgccca
961 aaagtttgaa ctcaccacac accagagaat tcatacagga gagcgaccct atgagtgtaa
1021 cgaatgtgca aaaaccttct ttaagaagtc aaaccttatc atacatcaga agattcacac
1081 gggggagaaa cgctatgagt gcagtgaatg tggaaaatcc tttatccaga actcacagct
1141 catcatacac atgagaactc atacaggaga gaaaccctat gaatgtactg agtgcggcaa
1201 aactttcagc cagaggtcaa ctcttagatt acacttgcga atccacacag gagagaaacc
1261 atatgagtgt tccgaatgtg ggaaggcctt tagcaggaag tcccgactca gtgtccatca
1321 gagagttcac atcggggaga aaccctgaaa ctccagccag gtcttactgt ggaaaactcc
1381 tgccagaact cttcaagcgg gtgaaaaacc tcatgacagt attgagggaa catgggaatt
1441 catactgaga tgcaatctct caactcaaaa atgtattaaa aataggatcc catgagaaca
1501 ttatactgga agttacatgt gatacccagc taaagaatac atatcagaat atatccagct
1561 gtaaatagcc atacccagtt gtactacaat gagcttttta aaatcttgaa tgaattgagt
1621 attctagaca gcagcataag aaatatacaa acagtatcct atgaatttag tggttttatg
1681 tggatatgcc acaaaacaca agtggtatgc tttagatctg cacatgtgaa tttagcataa
1741 tcactgggaa tttgaaattc ttgtcctctg tgataattag gacataacaa gattttccat
1801 actaaacatc acatgtgttt ttcagtatct ctgcaatcca gtatgcattc caaatgaaat
1861 gtgtaacatt taaagtagca tggaacctac gtctttccct actgcttgct ggcatatatc
1921 agttggtatg aacattgttc ttgagctgcc tcttaggaaa cagaagacag tgttgaagtt
1981 ttccctgctt ctggtttgct gaagattttc tagactgctt ctggtttgct gaagattttc
2041 tagaagcact atttacacaa atatgcaaat gtgaaataac cgatctataa cgtgaaggag
2101 gcagacatga gctgtactac tcagtatgca ccacagaata agagtttgcc gtgtaaagac
2161 aatatcccca ttcgtcatgc tcttattttc ccgtgggata tttgcataca aatgcatgtc
2221 tgttaccaaa atattgtgta acacagacag aaaccacctg tttttgtctt tccttgtttc
2281 ccttaatatt tcatgaattg tctagcaaaa atggtaggat gcttctgtag ttcacaaatg
2341 ttacatttca gagactttag aggaaaaatt attttaaata actgtcaact gtttcattgc
2401 tttttaaatt tttcacgtgc ataaccccct ttagaagtaa atttttacac tattttgttg
2461 tttaaaggag gcatttctac ttccttgagt tttgctgttg ccaacctaaa acatttccct
2521 ttggaacatg agttataagt tattactttt cctttacatg tttacacttt tataaaaatc
2581 agatttttca gtggtctctc cagatattaa caagaattgt tgtgtaactc aaagatttgc
2641 ttttatagac ttgatttcaa attcttaagt tcagcctttc cctatcaatc acaaatcatg
2701 tattggaaat tataaatggc aaccaaaaac tggcttttaa aaaatatttt tggatatcat
2761 tgatgtgctg tcacactata tattgagtga ctttctgaac aaatttatcc agaacatcca
2821 tagcccaata agcttttgtc taagttgtca tcttacttac tcacaaagga ggggaaaacg
2881 ttattttcat agctgctttt agaaatgtag attgtaacag cctccttgga caacattgtg
2941 agtctgtttt aacattaata tactcttaca acctaggaat ctcctgggaa tctatcccta
3001 aggaataaaa agcgccagca cttaagatta tatgtttact aatgtatatt gtattttttg
3061 gtaaggacca aaaaaacaaa caaaaaaaag accatcagta agggaatgga tgaataaatt
3121 gtggtaaaaa cataccatgg ctgaatggta tttccttgaa aagaatgtgt gggaacaaac
3181 tccaaacttc tctaggtcaa atgaggaaag caagagggga gagagagagt gtatgtgtgt
3241 gtgtagcagt ttttataaaa taaagataaa cccttataaa aaaaaaaaaa aaaaaaaa
//