LOCUS       BC019359                1548 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens tubulin, beta 2C, mRNA (cDNA clone MGC:13231
            IMAGE:4024979), complete cds.
ACCESSION   BC019359
VERSION     BC019359.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1548)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1548)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-DEC-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 18 Row: n Column: 8.
FEATURES             Location/Qualifiers
     source          1..1548
                     /db_xref="H-InvDB:HIT000038659"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:13231 IMAGE:4024979"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_20"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1548
                     /gene="TUBB2C"
                     /gene_synonym="TUBB2"
                     /db_xref="GeneID:10383"
                     /db_xref="HGNC:HGNC:20771"
                     /db_xref="MIM:602660"
     CDS             41..1378
                     /gene="TUBB2C"
                     /gene_synonym="TUBB2"
                     /codon_start=1
                     /product="tubulin, beta 2C"
                     /protein_id="AAH19359.1"
                     /db_xref="GI:17939577"
                     /db_xref="GeneID:10383"
                     /db_xref="HGNC:HGNC:20771"
                     /db_xref="MIM:602660"
                     /translation="MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL
                     ERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWA
                     KGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYP
                     DRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLT
                     TPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSR
                     GSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQ
                     NKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRK
                     AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA"
BASE COUNT          347 a          457 c          449 g          295 t
ORIGIN      
        1 gtctacttcc tcctgcttcc ccgccgccgc cgccgccatc atgagggaaa tcgtgcactt
       61 gcaggccggg cagtgcggca accaaatcgg cgccaagttt tgggaggtga tcagcgatga
      121 gcacggcatc gaccccacgg gcacctacca cggggacagc gacctgcagc tggaacgcat
      181 caacgtgtac tacaatgagg ccaccggcgg caagtacgtg ccccgcgccg tgctcgtgga
      241 tctggagccc ggcaccatgg actccgtgcg ctcggggccc ttcgggcaga tcttccggcc
      301 ggacaacttc gttttcggtc agagtggtgc tgggaacaac tgggccaagg ggcactacac
      361 agaaggcgcg gagctggtgg actcggtgct ggatgttgtg agaaaggagg ctgagagctg
      421 tgactgcctg cagggtttcc agctgaccca ctccctgggt ggggggactg ggtctgggat
      481 gggtaccctc ctcatcagca agatccggga ggagtaccca gacaggatca tgaacacgtt
      541 tagtgtggtg ccttcgccca aagtgtcaga cacagtggtg gagccctaca acgccaccct
      601 ctcagtccac cagctcgtag aaaacacaga cgagacctac tgcattgata acgaagctct
      661 ctacgacatt tgcttcagaa ccctaaagct gaccacgccc acctatggtg acctgaacca
      721 cctggtgtct gctaccatga gtggggtcac cacctgcctg cgcttcccag gccagctcaa
      781 tgctgacctg cggaagctgg ctgtgaacat ggtcccgttt ccccggctgc acttcttcat
      841 gcccggcttt gccccactga ccagccgggg cagccagcag taccgggcgc tgaccgtgcc
      901 cgagctcacc cagcagatgt ttgatgccaa gaacatgatg gctgcctgcg acccccgcca
      961 tggccgctac ctgacggttg ccgccgtgtt caggggccgc atgtccatga aggaggtgga
     1021 tgagcaaatg cttaatgtcc aaaacaaaaa cagcagctat tttgttgagt ggatccccaa
     1081 caatgtgaaa acggctgtct gtgacatccc acctcggggg ctaaaaatgt ccgccacctt
     1141 cattggcaac agcacggcca tccaggagct gttcaagcgc atctccgagc agttcacggc
     1201 catgttccgg cgcaaggcct tcctgcactg gtacacgggc gagggcatgg acgagatgga
     1261 gttcaccgag gccgagagca acatgaatga cctggtgtcc gagtaccagc agtaccagga
     1321 tgccacagcc gaggaggagg gcgagttcga ggaggaggct gaggaggagg tggcctagag
     1381 ccttcagtca ctggggaaag cagggaagca gtgtgaactc tttattcact cccagcctgt
     1441 cctgtggcct gtcccactgt gtgcacttgc tgttttccct gtccacatcc atgctgtaca
     1501 gacaccacca ttaaagcatt ttcatagtga aaaaaaaaaa aaaaaaaa
//