LOCUS       BC002967                2050 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens aldehyde dehydrogenase 2 family (mitochondrial), mRNA
            (cDNA clone MGC:1806 IMAGE:3543343), complete cds.
ACCESSION   BC002967
VERSION     BC002967.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2050)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2050)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Louis M. Staudt, M.D., Ph.D.
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 8 Row: e Column: 16
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 25777731.
FEATURES             Location/Qualifiers
     source          1..2050
                     /db_xref="H-InvDB:HIT000031323"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:1806 IMAGE:3543343"
                     /tissue_type="Lymph, Burkitt lymphoma"
                     /clone_lib="NIH_MGC_8"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2050
                     /gene="ALDH2"
                     /gene_synonym="ALDH-E2"
                     /gene_synonym="ALDHI"
                     /gene_synonym="ALDM"
                     /gene_synonym="MGC1806"
                     /db_xref="GeneID:217"
                     /db_xref="HGNC:HGNC:404"
                     /db_xref="MIM:100650"
     CDS             47..1600
                     /gene="ALDH2"
                     /gene_synonym="ALDH-E2"
                     /gene_synonym="ALDHI"
                     /gene_synonym="ALDM"
                     /gene_synonym="MGC1806"
                     /codon_start=1
                     /product="aldehyde dehydrogenase 2 family (mitochondrial)"
                     /protein_id="AAH02967.1"
                     /db_xref="GI:12804217"
                     /db_xref="GeneID:217"
                     /db_xref="HGNC:HGNC:404"
                     /db_xref="MIM:100650"
                     /translation="MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNE
                     WHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRG
                     RLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKT
                     IPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTA
                     LYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGS
                     SNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDE
                     FVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAA
                     DRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFT
                     KDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTV
                     TVKVPQKNS"
BASE COUNT          515 a          525 c          569 g          441 t
ORIGIN      
        1 gactagctct gctctcggtc cgctcgctgt ccgctagccc gctgcgatgt tgcgcgctgc
       61 cgcccgcttc gggccccgcc tgggccgccg cctcttgtca gccgccgcca cccaggccgt
      121 gcctgccccc aaccagcagc ccgaggtctt ctgcaaccag attttcataa acaatgaatg
      181 gcacgatgcc gtcagcagga aaacattccc caccgtcaat ccgtccactg gagaggtcat
      241 ctgtcaggta gctgaagggg acaaggaaga tgtggacaag gcagtgaagg ccgcccgggc
      301 cgccttccag ctgggctcac cttggcgccg catggacgca tcacacaggg gccggctgct
      361 gaaccgcctg gccgatctga tcgagcggga ccggacctac ctggcggcct tggagaccct
      421 ggacaatggc aagccctatg tcatctccta cctggtggat ttggacatgg tcctcaaatg
      481 tctccggtat tatgccggct gggctgataa gtaccacggg aaaaccatcc ccattgacgg
      541 agacttcttc agctacacac gccatgaacc tgtgggggtg tgcgggcaga tcattccgtg
      601 gaatttcccg ctcctgatgc aagcatggaa gctgggccca gccttggcaa ctggaaacgt
      661 ggttgtgatg aaggtagctg agcagacacc cctcaccgcc ctctatgtgg ccaacctgat
      721 caaggaggct ggctttcccc ctggtgtggt caacattgtg cctggatttg gccccacggc
      781 tggggccgcc attgcctccc atgaggatgt ggacaaagtg gcattcacag gctccactga
      841 gattggccgc gtaatccagg ttgctgctgg gagcagcaac ctcaagagag tgaccttgga
      901 gctggggggg aagagcccca acatcatcat gtcagatgcc gatatggatt gggccgtgga
      961 acaggcccac ttcgccctgt tcttcaacca gggccagtgc tgctgtgccg gctcccggac
     1021 cttcgtgcag gaggacatct atgatgagtt tgtggagcgg agcgttgccc gggccaagtc
     1081 tcgggtggtc gggaacccct ttgatagcaa gaccgagcag gggccgcagg tggatgaaac
     1141 tcagtttaag aagatcctcg gctacatcaa cacggggaag caagaggggg cgaagctgct
     1201 gtgtggtggg ggcattgctg ctgaccgtgg ttacttcatc cagcccactg tgtttggaga
     1261 tgtgcaggat ggcatgacca tcgccaagga ggagatcttc gggccagtga tgcagatcct
     1321 gaagttcaag accatagagg aggttgttgg gagagccaac aattccacgt acgggctggc
     1381 cgcagctgtc ttcacaaagg atttggacaa ggccaattac ctgtcccagg ccctccaggc
     1441 gggcactgtg tgggtcaact gctatgatgt gtttggagcc cagtcaccct ttggtggcta
     1501 caagatgtcg gggagtggcc gggagttggg cgagtacggg ctgcaggcat acactgaagt
     1561 gaaaactgtc acagtcaaag tgcctcagaa gaactcataa gaatcatgca agcttcctcc
     1621 ctcagccatt gatggaaagt tcagcaagat cagcaacaaa accaagaaaa atgatccttg
     1681 cgtgctgaat atctgaaaag agaaattttt cctacaaaat ctcttgggtc aagaaagttc
     1741 tagaatttga attgataaac atggtgggtt ggctgagggt aagagtatat gaggaacctt
     1801 ttaaacgaca acaatactgc tagctttcag gatgattttt aaaaaataga ttcaaatgtg
     1861 ttatcctctc tctgaaacgc ttcctataac tcgagtttat aggggaagaa aaagctattg
     1921 tttacaatta tatccccatt aaggcaactg ctacaccctg ctttgtattc tgggctaaga
     1981 ttcattaaaa actagctgct cttaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     2041 aaaaaaaaaa
//