LOCUS       BC002520                1139 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens COP9 constitutive photomorphogenic homolog subunit 6
            (Arabidopsis), mRNA (cDNA clone MGC:1263 IMAGE:3140042), complete
            cds.
ACCESSION   BC002520
VERSION     BC002520.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1139)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1139)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced gi:12803394.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 4 Row: e Column: 12.
FEATURES             Location/Qualifiers
     source          1..1139
                     /db_xref="H-InvDB:HIT000030959"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:1263 IMAGE:3140042"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1139
                     /gene="COPS6"
                     /gene_synonym="MOV34-34KD"
                     /db_xref="GeneID:10980"
                     /db_xref="HGNC:HGNC:21749"
     CDS             6..989
                     /gene="COPS6"
                     /gene_synonym="MOV34-34KD"
                     /codon_start=1
                     /product="COP9 constitutive photomorphogenic homolog
                     subunit 6 (Arabidopsis)"
                     /protein_id="AAH02520.2"
                     /db_xref="GI:33876808"
                     /db_xref="GeneID:10980"
                     /db_xref="HGNC:HGNC:21749"
                     /translation="MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALH
                     PLVILNISDHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELLSHTVEEKIIIDK
                     EYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKH
                     TDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVA
                     EHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFK
                     TDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF"
BASE COUNT          308 a          282 c          321 g          228 t
ORIGIN      
        1 ggaaaatggc ggcggcggcg gcggcggctg cagctacgaa cgggaccgga ggaagcagcg
       61 ggatggaggt ggatgcagca gtagtcccca gcgtgatggc ctgcggagtg actgggagtg
      121 tttccgtcgc tctccatccc cttgtcattc tcaacatctc agaccactgg atccgcatgc
      181 gctcccagga ggggcggcct gtgcaggtga ttggggctct gattggcaag caggagggcc
      241 gaaatatcga ggtgatgaac tcctttgagc tgctgtccca caccgtggaa gagaagatta
      301 tcattgacaa ggaatattat tacaccaagg aggagcagtt taaacaggtg ttcaaggagc
      361 tggagtttct gggttggtat accacagggg ggccacctga cccctcggac atccacgtcc
      421 ataagcaggt gtgtgagatc atcgagagcc ccctctttct gaagttgaac cctatgacca
      481 agcacacaga tcttcctgtc agcgtttttg agtctgtcat tgatataatc aatggagagg
      541 ccacaatgct gtttgctgag ctgacctaca ctctggccac agaggaagcg gaacgcattg
      601 gtgtagacca cgtagcccga atgacagcaa caggcagtgg agagaactcc actgtggctg
      661 aacacctgat agcacagcac agcgccatca agatgctgca cagccgcgtc aagctcatct
      721 tggagtacgt caaggcctct gaagcgggag aggtcccctt taatcatgag atcctgcggg
      781 aggcctatgc tctgtgtcac tgtctcccgg tgctcagcac agacaagttc aagacagatt
      841 tttatgatca atgcaacgac gtggggctca tggcctacct cggcaccatc accaaaacgt
      901 gcaacaccat gaaccagttt gtgaacaagt tcaatgtcct ctacgaccga caaggcatcg
      961 gcaggagaat gcgcgggctc tttttctgat gagggtactt gaagggctga tggacagggg
     1021 tcaggcaact atcccaaagg ggagggcact acacttcctt gagagaaacc gctgtcatta
     1081 ataaaagggg agcagcccct gagcaccaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa
//