LOCUS       AP011542                5838 bp    DNA     circular BCT 01-SEP-2010
DEFINITION  Bacillus subtilis subsp. natto BEST195 plasmid pBEST195S DNA,
            complete genome.
ACCESSION   AP011542
VERSION     AP011542.1
DBLINK      BioProject:PRJDA38027
            Sequence Read Archive:DRR000001
KEYWORDS    .
SOURCE      Bacillus subtilis subsp. natto BEST195
  ORGANISM  Bacillus subtilis subsp. natto BEST195
            Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
REFERENCE   1  (bases 1 to 5838)
  AUTHORS   Nishito,Y., Osana,Y., Popendorf,K., Toyoda,A., Fujiyama,A.,
            Itaya,M. and Sakakibara,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-2009) to the DDBJ/EMBL/GenBank databases.
            Contact:Yasubumi Sakakibara
            Keio University, Biosciences and Informatics; Kouhoku-ku, Hiyoshi
            3-14-1, Yokohama, Kanagawa 223-8522, Japan
REFERENCE   2
  AUTHORS   Nishito,Y., Osana,Y., Hachiya,T., Popendorf,K., Toyoda,A.,
            Fujiyama,A., Itaya,M. and Sakakibara,Y.
  TITLE     Whole genome assembly of a natto production strain Bacillus
            subtilis natto from very short read data
  JOURNAL   BMC Genomics 11, 243 (2010)
  REMARK    Publication Status: Online-Only
COMMENT     Gemome Coverage: 131x
            Sequencing Technology: Illumina Genome Analyzer II
FEATURES             Location/Qualifiers
     source          1..5838
                     /db_xref="taxon:645657"
                     /mol_type="genomic DNA"
                     /organism="Bacillus subtilis subsp. natto BEST195"
                     /plasmid="pBEST195S"
                     /strain="BEST195"
                     /sub_species="natto"
     CDS             166..1185
                     /codon_start=1
                     /gene="rep"
                     /locus_tag="BSNT_90002"
                     /note="from glimmer orf00002; involved in initiation of
                     replication"
                     /product="replication protein"
                     /protein_id="BAI87820.1"
                     /transl_table=11
                     /translation="MYSSENDYIILEDKTATGKKRDWKGKKRRTNLMAEHYEALQSKT
                     GIPYYGKKAEKLCSCAECLSFKRDPETGKLKLYQAQFCKVRLCPMCAWRRSLKIAYHN
                     KLIVEEANRQYGCGWIFLTLTVRNVEGDGLKPMIADMMKGWNRLFGYKRVKVATLGYF
                     RALEITKNHEEDTYHPHFHVLLPVKKSYFTHNYIKQSEWTSLWKRAMKLDYTPIVDIR
                     RVKGRAKIDAEQIESDVREAMMEQKAVLEISKYPVKDTDVVRGNKVTEDNLNTVFYLD
                     DALSARRLIGYGGILKEIHKELNLGDAEDGDLVKIEEEDDEVANEAFEVMAYWHPGIK
                     NYIIR"
     CDS             1324..1842
                     /codon_start=1
                     /locus_tag="BSNT_90003"
                     /note="from glimmer orf00003"
                     /product="hypothetical protein"
                     /protein_id="BAI87821.1"
                     /transl_table=11
                     /translation="MYICVVFSIILILFTSIEILLGGKVFMVTTIGKSKMWVGIIVVL
                     SLLLVSFSPAVKADTKDKYYSTTSTQSSTKSYRKANTSGVYVKVLKAGRSRDVAISVF
                     ADANKGKGKPHWVNVSGSDGATLGKYVTAGHTYHLTNYAVERYGKNVPIQLFVSNGSG
                     KKVEFYWSPDCR"
     CDS             1964..2524
                     /codon_start=1
                     /gene="sigP"
                     /locus_tag="BSNT_90005"
                     /note="from glimmer orf00005; involved in processing of
                     pre-proteins"
                     /product="type I signal peptidase"
                     /protein_id="BAI87822.1"
                     /transl_table=11
                     /translation="MTKEKVFKKKSSILEWGKAIVIAVILALLIRNFLFEPYVVEGKS
                     MDPTLVDSERLFVNKTVKYTGNFKRGDIIILNGKEKSTHYVKRLIGLPGDTVEMKNDH
                     LFINGNEVKEPYLSYNKENAKKVGINLTGDFGPIKVPKDKYFVMGDNRQESMDSRNGL
                     GLFTKDDIQGTEEFVFFPFSNMRKAK"
     CDS             2859..4307
                     /codon_start=1
                     /gene="mob"
                     /locus_tag="BSNT_90006"
                     /note="from glimmer orf00006"
                     /product="mobilization protein"
                     /protein_id="BAI87823.1"
                     /transl_table=11
                     /translation="MANYAVIRMEKYKKDRLNGTQKHNQREFQKSKNENIDRERTHLN
                     YDLVNEKPISYSKAIHEKIEGRVKRKVRADAVLVSEFLITASPDYMNGLSDEEQRRYF
                     ETAVDHLKEKYSAENMLYATVHMDEATPHMHVGIVPITEDGRLSAKDFFNGKLKMKAI
                     QDDFHRHMVENGFDLVRGEPSEKKHENVHQYKINQRQAELERLNAEIALKEKQREELE
                     KQNKAVQAVIEVKKESLTAKAEELKMPTIEHEKAWLKKDKVIVPERELHALYAYAEQK
                     TKTAAELAGQLKSETQEKERWQSIARQEADRADEKDQRLQELQSRIHSEVEASKKEMR
                     RKLAKEFTEEQRQDLRQEVKEELTTLRTENEELSAENKVLIIQRNSEAAESLKLKQEL
                     DKRNGQYAEVLSFAKKQNQTLEKVAGENKALKKENKTLKERVAVLEQWKDKMVQWAKE
                     KLPKMRKLAASFFRTAGMPREANKYKDNELER"
     CDS             complement(4318..4797)
                     /codon_start=1
                     /locus_tag="BSNT_90007"
                     /note="from glimmer orf00007"
                     /product="putative DNA-binding protein"
                     /protein_id="BAI87824.1"
                     /transl_table=11
                     /translation="MDMGIKLSSKDVAKHLGIEPVTVRKYASMLEEQGYSFNKDSKGW
                     RLYTEDDVKTLEYLCTMTKINGHSLDETVKHIASLYRSKLTISDTATSLQDNPLVEFM
                     KRQEEFNRHMAERMERFEKRQQERHETLTAALRESLETQKMIAATKQKKWWKFWKGN"
     CDS             4926..5087
                     /codon_start=1
                     /locus_tag="BSNT_90008"
                     /note="from glimmer orf00008"
                     /product="hypothetical protein"
                     /protein_id="BAI87825.1"
                     /transl_table=11
                     /translation="MSDFETGMRYVRATLGFEGLVLTEEEEKLLERRFHGEITEEEYI
                     QKAFELSLM"
BASE COUNT         1814 a          964 c         1415 g         1645 t
ORIGIN      
        1 ttgatactat atagaaacat ctcaaggcga aaaaatagcc cccatccctt atttgtcaag
       61 ggtttgacgg ctttttgaca tgtagaaact ccttccgcta ttattaaagt gcccactaaa
      121 ataatagaat gctagattac tagctcagaa ggagtttttt tgttcatgta ttcatctgaa
      181 aatgattata tcatccttga ggacaagacc gcaacaggta aaaagcggga ttggaagggg
      241 aaaaagagac ggacgaatct tatggctgag cactatgaag ctttacagag taaaactggt
      301 ataccttact atggcaaaaa agctgagaaa ttgtgcagtt gtgcggaatg tctttcgttt
      361 aaacgagacc cggagacggg caaattaaag ttgtatcaag ctcagttttg taaagtgagg
      421 ttatgcccga tgtgtgcgtg gcgtaggtct ttaaaaattg cttatcataa taaattaatc
      481 gttgaggaag cgaatcggca gtacggttgt ggatggattt ttctcacact gacggttcgg
      541 aatgtcgagg gtgacggatt aaaacccatg attgctgaca tgatgaaagg atggaaccgc
      601 cttttcggat ataaacgagt taaggtagcg actttaggtt atttcagagc tttagagatt
      661 accaaaaatc acgaagaaga tacatatcat ccgcattttc atgtgttgtt gcctgtgaag
      721 aaaagctatt ttactcacaa ttacattaag cagtctgagt ggacgagctt atggaaaagg
      781 gcgatgaaac tggactacac gccgattgtt gatatccgaa gagtcaaggg aagagctaaa
      841 attgatgccg aacagattga gagcgatgtg cgggaagcca tgatggagca aaaagctgtt
      901 cttgaaatct ctaaatatcc ggttaaagat acggatgttg tgcgcggcaa taaggtgaca
      961 gaagacaatc tgaacacggt gttttatttg gatgatgcgc tttctgcccg ccggcttatt
     1021 ggttacggtg gcatcttgaa ggaaattcat aaagaactaa acctcggtga tgcggaggac
     1081 ggcgatctcg tcaagattga ggaagaagat gacgaggtgg cgaacgaagc atttgaagtt
     1141 atggcttact ggcatccagg cattaaaaat tacataatca gataaaaagc aggcgttgtt
     1201 cctgcttttt ttatactcta atagtcaaat caagagttaa ttttagatgt aattgtgaga
     1261 attagagtgg ctgaccagta tttgaaactt cttgggctac tttcttaact ttatattaaa
     1321 actatgtata tatgtgttgt tttttctatt attttgatat tatttacaag tattgaaatt
     1381 ttgctaggag ggaaagtttt tatggttacc acgattggta aaagtaagat gtgggtaggt
     1441 attattgttg tattatcttt attattggta tctttttcgc ctgctgtaaa ggctgatact
     1501 aaggataaat attattctac aacttctacc caatcttcaa caaaaagtta tcgtaaagct
     1561 aatactagtg gggtctatgt gaaagtactt aaagctggac gttctcgtga tgttgctatt
     1621 tcagtttttg ctgatgcgaa caaagggaaa ggaaagccac attgggtaaa tgtttctggt
     1681 agcgatggcg ctactctggg aaaatacgtg actgcagggc atacatatca tcttacaaac
     1741 tatgctgtag aacgttatgg aaagaatgtt cctatacaat tatttgtttc taatggttct
     1801 ggcaaaaaag ttgaatttta ttggagtccc gattgtagat agtccaaata gcagatgatg
     1861 aaaaagcagg attaatcctg ctagcaggat taatcctgct tttttatttt tgttttggta
     1921 aaatgtgata agcgggtttt gaaatataga ggaggaaatt tctttgacaa aagagaaagt
     1981 tttcaaaaag aaaagctcta ttttagagtg gggcaaggct attgtgatag ctgttatact
     2041 tgctcttctt attcggaatt ttttgtttga gccatatgtg gtagaaggga agtctatgga
     2101 tcccactttg gttgattctg aaagattatt tgtaaataag actgtgaagt atacaggtaa
     2161 ttttaaacga ggggatataa taattttaaa cggaaaggaa aaaagcacac attatgtgaa
     2221 gcgattaatt ggtttacctg gagacactgt agaaatgaag aatgaccacc tttttattaa
     2281 tggaaatgaa gttaaggaac catatctttc ttataataaa gaaaatgcta agaaagtggg
     2341 tataaacctt acaggagatt ttggaccaat taaagttcca aaagataaat attttgttat
     2401 gggcgataac cgacaagaat caatggatag tcgtaatggg cttggactct ttactaaaga
     2461 tgatattcag ggaaccgaag agttcgtatt ttttccattt agtaatatgc gaaaagctaa
     2521 ataattttta gaccgaaaca ggctataagg tctgtttttt cattttgtta tgaacattta
     2581 gcacacagat caaagttttc atagtttgaa tgctttgata gcagcaaagg gtatttctga
     2641 ttttctgccg atctctcatc ggcggaaaag tcgggtcggc ggacagccga caagtggcac
     2701 gaactttcga tgcgacagcg agaatgagag agccaccagc accgcaggtc gcacgtccaa
     2761 atttgccatg ggcataattt ggtgtagtgc gttacaccaa agataaactt tgtgttacca
     2821 taacccctat acagtggtct gaatcggggg tttttctcat ggcaaattat gcagtcatca
     2881 ggatggaaaa atacaaaaaa gatagattga atggaacgca aaaacacaat cagcgggagt
     2941 ttcaaaaaag caaaaatgaa aatattgatc gggagcggac gcacttaaat tatgatctag
     3001 tgaacgagaa accgattagc tattcaaaag cgattcatga aaaaattgag gggcgagtca
     3061 aacggaaggt ccgagcggat gctgttttgg tcagcgaatt tttgatcacg gcaagtcctg
     3121 actatatgaa tgggctgagc gatgaggagc agcggcgcta ttttgaaaca gcggttgatc
     3181 atttgaaaga gaaatacagc gctgaaaaca tgctttatgc tacagtccat atggatgaag
     3241 cgactcctca tatgcatgtt ggtattgtac cgatcacaga ggacggccga ctctctgcga
     3301 aagatttttt taatggcaaa ttgaagatga aagccattca agatgatttt catcggcaca
     3361 tggttgaaaa cggttttgac ctggtgcgcg gcgaaccaag cgaaaagaag catgagaatg
     3421 ttcaccagta taaaataaat cagcggcaag cggagcttga gcggcttaat gctgaaattg
     3481 ctttaaagga aaagcagaga gaggaactgg aaaagcaaaa caaagctgtt caagcagtta
     3541 tagaagtgaa aaaagaatcg ctgacagcta aggctgaaga gttgaaaatg ccgactattg
     3601 aacatgaaaa agcgtggctc aaaaaggata aagtcattgt gccagagcgg gaactccatg
     3661 ctttgtatgc ctatgcggag cagaaaacta aaacggcagc cgagttggcg gggcaattga
     3721 agtcggaaac gcaggaaaag gagcgctggc agtctatcgc ccggcaggaa gcagatcggg
     3781 cggatgaaaa agaccaacgg cttcaggaac tgcagagtag gatccattca gaagttgaag
     3841 cgtccaaaaa ggaaatgcgg cgcaagcttg caaaggaatt tacggaagaa cagcgtcagg
     3901 atcttcggca ggaagtgaaa gaggaactga cgactttacg aacggaaaac gaggaactgt
     3961 cagctgaaaa taaagttttg atcattcaaa gaaatagcga agctgcggag agcctaaaac
     4021 taaaacagga acttgataag agaaacgggc agtatgctga ggttttgagt ttcgccaaga
     4081 agcagaatca aacgcttgaa aaagtggctg gagaaaacaa ggcgttaaaa aaagaaaata
     4141 agacactaaa agagagagtt gccgtactgg aacaatggaa agacaaaatg gttcagtggg
     4201 ctaaagaaaa attaccaaag atgcggaaat tagcggcatc gtttttccgt acggctggaa
     4261 tgcctagaga agccaataaa tacaaggaca atgaattaga gcggtgaaaa cgggcaatca
     4321 attgcccttc caaaatttcc accacttttt ttgtttggtg gctgcgatca ttttttgtgt
     4381 ctcaagggac tcacgtaatg cagcggtgag tgtctcgtgc ctttcttgct gtcttttttc
     4441 gaatcgttcc atccgttctg ccatgtggcg gttgaattct tcctgtcgtt tcatgaattc
     4501 gactaaagga ttgtcctgta gcgatgtagc ggtatccgat atggtcagtt tagaacgata
     4561 taagcttgct atgtgcttta ccgtttcgtc gagtgagtgt ccattgatct tagtcattgt
     4621 acatagatac tctaaagtct ttacgtcatc ctcggtatag agtcgccatc ctttcgaatc
     4681 tttattgaac gagtagcctt gttcttcaag catactggca tacttgcgga cagttactgg
     4741 ctctataccg aggtgttttg cgacgtcctt tgatgataat ttgattccca tatccataac
     4801 gtatcacctc gtaaaaaggg ttcgctatag tgagggcaaa gccctttatt tagagccatt
     4861 taaaaagaaa gctgttccgt tcttttatca ggttgggact gtatttagtt tatgggggag
     4921 tgccaatgag tgattttgaa acaggaatga gatatgtaag agcaaccctt ggctttgagg
     4981 gtttagtgct gacggaagaa gaggaaaagc ttttagaaag acggtttcat ggagaaatca
     5041 cagaggaaga atacatacaa aaagcgtttg agctttcttt gatgtgatgt acctgcaggg
     5101 gcttataata ttcatagctg ttgttagaac ctaaaccctt ttaccgtttt tggcggtgag
     5161 ggttcttttt ttttaggcag tgatgcgatt ttggcgtgag tcaacggtaa ccggaccgta
     5221 gggaggatta aggagttgac tcgctcagcg ccacccgaac cctttcagca ctcaaacaaa
     5281 cccgtttgtt tgacgccaac cggcgaggga gccccccgaa gaagcggggg gttgggggga
     5341 ttgaatgctg gcatccaacg gccgtccgtt ggtgggtttg ggcaaagccc aagaactgtt
     5401 gcaaggctcg ttgagaataa agaatgcttt tcaggatgct tagaatcgtt tctgagagct
     5461 tcaaataaaa aagatgacct tttatagggg gaagctctta aaattgaatg taggggcatt
     5521 taaacacgtt taaaaataaa aaaagcagac tctttagagt ccgccttgtt atttttaacc
     5581 cagtgctcca ttttcggctg tttggaaatc ttttgagatg ccgaaccatc cattttcttt
     5641 tgttccatga aaaaagtgct tttggatgct taaaaaggct ttttcgtata aaaaaagccg
     5701 atttttgaaa aaaaaatctc cccccctgcg ggggaagaat ggttttgatc tttgggtttt
     5761 aggttttaaa aaaagccggc tgttttcagc cggctttttt tcgattttgg cggagccgaa
     5821 atcgggtctt ttcttatc
//