LOCUS       AL354615                3840 bp    mRNA    linear   HUM 15-OCT-2008
DEFINITION  Novel human gene mapping to chomosome 1.
ACCESSION   AL354615
VERSION     AL354615.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3840)
  AUTHORS   Rhodes,S. and  Huckle,E.
  JOURNAL   Submitted (27-APR-2000) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 37C10 (AL049569).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr1/
            Experimentally determined gene
            Sanger Centre name : dJ37C10.C1.3
FEATURES             Location/Qualifiers
     source          1..3840
                     /db_xref="H-InvDB:HIT000250333"
                     /organism="Homo sapiens"
                     /chromosome="1"
                     /map="1p36"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     exon            1..44
                     /number=1
     CDS             35..3577
                     /product="hypothetical protein"
                     /db_xref="GOA:Q9NQ11"
                     /db_xref="H-InvDB:HIT000250333.13"
                     /db_xref="HGNC:HGNC:30213"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/Swiss-Prot:Q9NQ11"
                     /protein_id="CAB89728.1"
                     /translation="MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSP
                     WRVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQL
                     FTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQK
                     RVLRYYLFQGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGP
                     NVISIPVKSYPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLY
                     KTRKQSQTLRDMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALV
                     AGECMVNESSLTGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVL
                     AVVTRTGFCTAKGGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRN
                     RVPLNEIVIRALDLVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLGGKLQ
                     LVCFDKTGTLTEDGLDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQD
                     TPVGDPMDLKMVESTGWVLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSV
                     LHRFPFSSALQRMSVVVAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTA
                     AGYRVVALASKPLPTVPSLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALR
                     RTRIRAVMVTGDNLQTAVTVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPT
                     AVNGVKDPDQAASYTVEPDPRSRHLALSGPTFGIIVKHFPKLLPKVLVQGTVFARMAP
                     EQKTELVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIE
                     CVPMVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITT
                     TVAVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFV
                     PLNRTVAAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPFLVALALL
                     SSVLVGLVLVPGLLQGPLALRNITDTGFKLLLLGLVTLNFVGAFMLESVLDQCLPACL
                     RRLRPKRASKKRFKQLERELAEQPWPPLPAGPLR"
     exon            45..139
                     /number=2
     exon            140..322
                     /number=3
     misc_feature    complement(join(321..366,365..381))
                     /note="matches EST AA601386 from clone IMAGE:1100856"
     exon            323..381
                     /number=4
     exon            382..511
                     /number=5
     exon            512..591
                     /number=6
     misc_feature    521..591
                     /note="matches EST AA367383"
     misc_feature    582..957
                     /note="matches EST AW503046 from clone IMAGE:3073988"
     misc_feature    582..1055
                     /note="matches EST AW503042 from clone IMAGE:3073970"
     exon            592..669
                     /number=7
     exon            670..739
                     /number=8
     exon            740..874
                     /number=9
     exon            875..941
                     /number=10
     exon            942..1073
                     /number=11
     misc_feature    1072..1235
                     /note="matches EST AA326792"
     exon            1074..1229
                     /number=12
     misc_feature    1159..1416
                     /note="matches EST T19151 from clone a10004"
     exon            1230..1340
                     /number=13
     exon            1341..1387
                     /number=14
     exon            1388..1576
                     /number=15
     misc_feature    1528..1913
                     /note="matches EST AW247062 from clone IMAGE:2822594"
     exon            1577..1783
                     /number=16
     misc_feature    1767..1975
                     /note="matches EST T09153 from clone HIBBP79"
     exon            1784..1879
                     /number=17
     exon            1880..2039
                     /number=18
     exon            2040..2160
                     /number=19
     exon            2161..2285
                     /number=20
     exon            2286..2446
                     /number=21
     misc_feature    join(2287..2459,2561..2956)
                     /note="matches EST AW163138 from clone IMAGE:2783726"
     exon            2447..2563
                     /number=22
     exon            2564..2643
                     /number=23
     misc_feature    2643..2886
                     /note="matches EST AA359097"
     exon            2644..2796
                     /number=24
     exon            2797..2893
                     /number=25
     exon            2894..3117
                     /number=26
     exon            3118..3269
                     /number=27
     misc_feature    complement(join(3179..3208,3231..3834))
                     /note="matches EST AI694453 from clone IMAGE:2338239"
     exon            3270..3439
                     /number=28
     misc_feature    complement(join(3393..3472,3558..3805,3806..3840))
                     /note="matches EST AA977749 from clone IMAGE:1589627"
     misc_feature    join(3421..3488,3493..3702)
                     /note="matches EST H20364 from clone IMAGE:172875"
     exon            3440..3840
                     /number=29
     misc_feature    complement(3476..3840)
                     /note="matches EST AI015711 from clone IMAGE:1636139"
     misc_feature    complement(join(3508..3644,3636..3824))
                     /note="matches EST AI560050 from clone IMAGE:2211121"
     misc_feature    complement(3540..3840)
                     /note="matches EST AI061266 from clone IMAGE:1699709"
     misc_feature    complement(3558..3840)
                     /note="matches EST AI380589 from clone IMAGE:2107078"
     misc_feature    complement(3559..3840)
                     /note="matches EST AI334403 from clone IMAGE:1933609"
     misc_feature    complement(3582..3840)
                     /note="matches EST AW081719 from clone IMAGE:2587072"
     misc_feature    complement(3602..3840)
                     /note="matches EST R58916"
     misc_feature    complement(3679..3840)
                     /note="matches EST AW591743 from clone IMAGE:2793472"
     misc_feature    complement(3700..3840)
                     /note="matches EST AI887158 from clone IMAGE:2438061"
     misc_feature    complement(3728..3840)
                     /note="matches EST AI954171 from clone IMAGE:2549985"
BASE COUNT          682 a         1277 c         1162 g          719 t
ORIGIN
        1 gcgccggggc cggcgatgag cgcgaggagc cggcatgagc gcagacagca gccctctcgt
       61 gggcagcacg cccaccggtt atgggaccct gacgataggg acatcaatag atcccctcag
      121 ctcctcagtt tcatccgtga ggctcagcgg ctactgtggc agtccatgga gggtcatcgg
      181 ctatcacgtc gtggtctgga tgatggctgg gatccctttg ctgctcttcc gttggaagcc
      241 cctgtggggg gtgcggctgc ggctccggcc ctgcaacctg gcccacgccg aaacactcgt
      301 tatcgaaata agagacaaag aggatagttc ctggcagctc ttcactgtcc aggtgcagac
      361 tgaggccatc ggcgagggca gcctggagcc gtccccacag tcccaggcag aggatggccg
      421 gagccaggcg gcagttgggg cggtaccaga gggtgcctgg aaggatacgg cccagctcca
      481 caagagcgag gaggcggtga gtgtcggaca gaagcgggtg ctgcggtatt acctcttcca
      541 gggccagcgc tatatctgga tcgagaccca gcaagccttc taccaggtca gcctcctgga
      601 ccatggccgc tcttgtgacg acgtccaccg ctcccgccat ggcctcagcc tccaggacca
      661 aatggtgagg aaggccattt acggccccaa cgtgatcagc ataccggtca agtcctaccc
      721 ccagctgctg gtggacgagg cactgaaccc ctactatggg ttccaggcct tcagcatcgc
      781 gctgtggctg gctgaccact actactggta cgccctgtgc atcttcctca tttcctccat
      841 ctccatctgc ctgtcgctgt acaagaccag aaagcaaagc cagactctaa gggacatggt
      901 caagttgtcc atgcgggtgt gcgtgtgccg gccaggggga gaggaagagt gggtggactc
      961 cagtgagcta gtgcccggag actgcctggt gctgccccag gagggtgggc tgatgccctg
     1021 tgatgccgcc ctggtggccg gcgagtgcat ggtgaatgag agctctctga caggagagag
     1081 cattccagtg ctgaagacgg cactgccgga ggggctgggg ccctactgtg cagagacaca
     1141 ccggcggcac acactcttct gcgggaccct catcttgcag gcccgggcct atgtgggacc
     1201 gcacgtcctg gcagtggtga cccgcacagg gttctgcacg gcaaaagggg gcctggtgag
     1261 ctccatcttg cacccccggc ccatcaactt caagttctat aaacacagca tgaagtttgt
     1321 ggctgccctc tctgtcctgg ctctcctcgg caccatctac agcatcttca tcctctaccg
     1381 aaaccgggtg cctctgaatg agattgtaat ccgggctctc gacctggtga ccgtggtggt
     1441 gccacctgcc ctgcctgctg ccatgactgt gtgcacgctc tacgcccaga gccgactgcg
     1501 gagacagggc attttctgca tccacccact gcgcatcaac ctggggggca agctgcagct
     1561 ggtgtgtttc gacaagacgg gcaccctcac tgaggacggc ttagacgtga tgggggtggt
     1621 gcccctgaag gggcaggcat tcctgcccct ggtcccagag cctcgccgcc tgcctgtggg
     1681 gcccctgctc cgagcactgg ccacctgcca tgccctcagc cggctccagg acacccccgt
     1741 gggcgacccc atggacttga agatggtgga gtctactggc tgggtcctgg aggaagagcc
     1801 ggctgcagac tcagcatttg ggacccaggt cttggcagtg atgagacccc cactttggga
     1861 gccccagctg caggcaatgg aggagccccc ggtgccagtc agcgtcctcc accgcttccc
     1921 cttctcttcg gctctgcagc gcatgagtgt ggtggtggcg tggccagggg ccactcagcc
     1981 cgaggcctac gtcaaaggct ccccggagct ggtggcaggg ctctgcaacc ccgagacagt
     2041 gcccaccgac ttcgcccaga tgctgcagag ctatacagct gctggctacc gtgtcgtggc
     2101 cctggccagc aagccactgc ccactgtgcc cagcctggag gcagcccagc aactgacgag
     2161 ggacactgtg gaaggagacc tgagcctcct ggggctgctg gtcatgagga acctactgaa
     2221 gccgcagaca acgccagtta tccaggctct gcgaaggacc cgcatccgcg ccgtcatggt
     2281 gacaggggac aacctgcaga cagcggtgac tgtggcccgg ggctgtggca tggtggcccc
     2341 ccaggagcat ctgatcatcg tccacgccac ccaccctgag cggggtcagc ctgcctctct
     2401 cgagttcctg ccgatggagt cccccacagc cgtgaatggc gttaaggatc ctgaccaggc
     2461 tgcaagctac accgtggagc cagacccccg atccaggcac ctggccctca gcgggcccac
     2521 ctttggtatc attgtgaagc acttccccaa gctgctgccc aaggtcctgg tccagggcac
     2581 tgtctttgcc cgcatggccc ctgagcagaa gacagagctg gtgtgcgagc tacagaagct
     2641 tcagtactgc gtgggcatgt gcggagacgg cgccaatgac tgtggggccc tgaaggcggc
     2701 tgatgtcggc atctcgctgt cccaggcaga agcctcagtg gtctcaccct tcacctcgag
     2761 catggccagt attgagtgcg tgcccatggt catcagggag gggcgctgtt cccttgacac
     2821 ttcgttcagc gtcttcaagt acatggctct gtacagcctg acccagttca tctccgtcct
     2881 gatcctctac acgatcaaca ccaacctggg tgacctgcag ttcctggcca tcgacctggt
     2941 catcaccacc acagtggcag tgctcatgag ccgcacgggg ccagcgctgg tcctgggacg
     3001 ggtgcggcca ccgggggcgc tgctcagcgt gcccgtgctc agcagcctgc tgctgcagat
     3061 ggtcctggtg accggcgtgc agctaggggg ctacttcctg accctggccc agccatggtt
     3121 cgtgcctctg aacaggacag tggccgcacc agacaacctg cccaactacg agaacaccgt
     3181 ggtcttctct ctgtccagct tccagtacct catcctggct gcagccgtgt ccaagggggc
     3241 gcccttccgc cggccgctct acaccaatgt gcccttcctg gtggccctgg cgctcctgag
     3301 ctccgtcctg gtgggccttg tcctggtccc cggcctcctg caggggccgc tggcgctgag
     3361 gaacatcact gacaccggct tcaagctgct gctgctgggt ctggtcaccc tcaacttcgt
     3421 gggggccttc atgctggaga gcgtgctaga ccagtgcctc cccgcctgcc tgcgccgcct
     3481 ccggcccaag cgggcctcca agaagcgctt caagcagctg gaacgagagc tggccgagca
     3541 gccctggccg ccgctgcccg ccggccccct gaggtagtgc aggcccacgg gcaccccaga
     3601 cactggaact ccctgcctct gagccaccaa ctggacccct ctccagcaac accaccgcca
     3661 ccacctccca catccctgag gttggcgact gtctacactc ctcccccgag accaccccca
     3721 ccctggggaa gcgttgacta ctgtccccta ccttggacca tcccgcgtag gggtggcagc
     3781 ccccagctcc cctcagtgct gctgtcagtg tagcaaataa agtcatgata ttttcctggc
//