LOCUS AK313158 774 bp mRNA linear HTC 24-MAY-2008 DEFINITION Homo sapiens cDNA, FLJ93653, Homo sapiens insulin-like growth factor binding protein 6 (IGFBP6),mRNA. ACCESSION AK313158 VERSION AK313158.1 KEYWORDS HTC; HTC_FLI; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 774) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K., Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T., Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S., Goshima,N., Nomura,N. and Isogai,T. TITLE NEDO functional analysis of protein and research application project JOURNAL Unpublished (2008) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC and Biological Information Research Center (BIRC), AIST; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..774 /cell_type="coronary artery smooth muscle cells (HCASMC)" /clone="HCASM2001345" /clone_lib="HCASM2" /db_xref="H-InvDB:HIT000432024" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="primary culture, coronary artery smooth muscle cells" /organism="Homo sapiens" CDS 52..774 /note="Homo sapiens insulin-like growth factor binding protein 6 (IGFBP6),mRNA" /protein_id="BAG35976.1" /translation="MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGC VEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRG RCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEM GPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRM GKSLPGSPDGNGSSSCPTGSSG" BASE COUNT 144 a 247 c 264 g 119 t ORIGIN 1 agctgcgctg cgactgctct ggaaggagag gacggggcac aaaccctgac catgaccccc 61 cacaggctgc tgccaccgct gctgctgctg ctagctctgc tgctcgctgc cagcccagga 121 ggcgccttgg cgcggtgccc aggctgcggg caaggggtgc aggcgggttg tccagggggc 181 tgcgtggagg aggaggatgg ggggtcgcca gccgagggct gcgcggaagc tgagggctgt 241 ctcaggaggg aggggcagga gtgcggggtc tacaccccta actgcgcccc aggactgcag 301 tgccatccgc ccaaggacga cgaggcgcct ttgcgggcgc tgctgctcgg ccgaggccgc 361 tgccttccgg cccgcgcgcc tgctgttgca gaggagaatc ctaaggagag taaaccccaa 421 gcaggcactg cccgcccaca ggatgtgaac cgcagagacc aacagaggaa tccaggcacc 481 tctaccacgc cctcccagcc caattctgcg ggtgtccaag acactgagat gggcccatgc 541 cgtagacatc tggactcagt gctgcagcaa ctccagactg aggtctaccg aggggctcaa 601 acactctacg tgcccaattg tgaccatcga ggcttctacc ggaagcggca gtgccgctcc 661 tcccaggggc agcgccgagg tccctgctgg tgtgtggatc ggatgggcaa gtccctgcca 721 gggtctccag atggcaatgg aagctcctcc tgccccactg ggagtagcgg ctaa //