LOCUS AK297990 985 bp mRNA linear HUM 24-JUL-2008 DEFINITION Homo sapiens cDNA FLJ52003 complete cds, highly similar to Homo sapiens nucleoredoxin (NXN), mRNA. ACCESSION AK297990 VERSION AK297990.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 985) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project focused on splicing variants JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..985 /clone="HLUNG2000237" /clone_lib="HLUNG2" /db_xref="H-InvDB:HIT000492614" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" /tissue_type="lung" CDS 137..517 /codon_start=1 /note="highly similar to Homo sapiens nucleoredoxin (NXN), mRNA" /protein_id="BAG60298.1" /transl_table=1 /translation="MPWLAVPYTDEARRSRLNRLYGIQDSEDDGESEAAKQLIQPIAE KIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVE EITPAIVEAFVNDFLAEKLKPEPI" BASE COUNT 195 a 299 c 301 g 190 t ORIGIN 1 gtgtccgccc tgccgaagcc tcacccgggt cctggtggaa tcctaccgga agatcaagga 61 ggcaggccag aacttcgaga tcatcttcgt tagtgcagac aggtcggagg agtccttcaa 121 acagtacttc agtgagatgc cctggctcgc cgtcccctac acggatgagg cccggcggtc 181 gcgcctcaac cggctgtacg gaatccaaga ttctgaggat gacggagagt ccgaggcggc 241 caagcagctg attcagccga tagctgagaa aatcattgcc aagtacaaag ccaaagagga 301 ggaggcaccc cttctgttct tcgtagccgg ggaggatgac atgactgact ccctgcgaga 361 ttacaccaac ctgcctgagg ctgccccttt gctcaccatc ctggacatgt cagcccgggc 421 caagtacgtg atggacgtgg aggagatcac ccccgccatc gtggaggcct ttgtgaatga 481 cttcctagca gagaagctca aaccggagcc catctagcgt ggctccggcc tcctgagacg 541 ttatttaaaa ctcagccttc tcctcctccc cctccttcct tccgcccttg gacttaccca 601 gcgtgccccg aatcccacca cccaagtgtc cagcctctct gtggtgcctt gtttctgcag 661 taacctcctc agccagcacc ctggggtgcg gaatcagcag cggcagagtc caccgtgttt 721 ggagactctg tttgggagca cgggatggcc gggggcccgg ccagagcggg gctgcatggc 781 tttcgcaaag tcactagctt ttggtgaagg atctgccagg gtgtcctggg cagagtgagc 841 gtggagggcc ggtgggtccc gctcgggctc tgactctgac gtcggcacac acggccccgg 901 acggccagag gggaaccgcc gggtgacacc tgcgtggagg ctgagctgag aaagggcctc 961 cgcttagagc tgcgggtgag gacgt //