LOCUS AJ289118 600 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens partial mRNA for CD1E antigen, isoform 8 (CD1E gene). ACCESSION AJ289118 VERSION AJ289118.1 KEYWORDS CD1E gene; CD1e protein. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 600) AUTHORS De la salle H. JOURNAL Submitted (16-MAY-2000) to the INSDC. de la Salle H., INSERM EPI 99-08, EFS Alsace, 10 Rue Spielmann BP65, 67065, FRANCE. REFERENCE 3 AUTHORS Angenieux C., Salamero J., Fricker D., Cazenave J.P., Goud B., Hanau D., De la salle H. TITLE Characterization of CD1e, a third type of CD1 molecule expressed in dendritic cells JOURNAL J Biol Chem 275(48), 37757-37764(2000). PUBMED 10948205 FEATURES Location/Qualifiers source 1..600 /db_xref="H-InvDB:HIT000246532" /organism="Homo sapiens" /mol_type="mRNA" /country="France" /cell_type="dendritic cells" /db_xref="taxon:9606" CDS <1..>598 /codon_start=1 /gene="CD1E" /product="CD1E antigen, isoform 8" /db_xref="GOA:P15812" /db_xref="H-InvDB:HIT000246532.13" /db_xref="HGNC:HGNC:1638" /db_xref="InterPro:IPR003597" /db_xref="InterPro:IPR007110" /db_xref="InterPro:IPR011161" /db_xref="InterPro:IPR011162" /db_xref="InterPro:IPR013783" /db_xref="InterPro:IPR036179" /db_xref="InterPro:IPR037055" /db_xref="PDB:3S6C" /db_xref="UniProtKB/Swiss-Prot:P15812" /experiment="experimental evidence, no additional details recorded" /protein_id="CAB93157.1" /translation="MLLLFLLFEGLCCPGENTAVKPEAWLSCGPSPGPGRLQLVCHVS GFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATLDVAAGEAAGLSCRVKHSS LGGHDLIIHWGGYSIFLILICLTVIVTLVILVVVDSRLKKQSSNKNILSPHTPSPVFL MGANTQDTKNSRHQFCLAQVSWIKNRVLKKWKTRLNQLW" sig_peptide 1..24 /gene="CD1E" mat_peptide 25..598 /gene="CD1E" /product="CD1E antigen, isoform 8" BASE COUNT 137 a 153 c 165 g 145 t ORIGIN 1 atgctgctcc tgttcctcct cttcgagggt ctctgctgtc ctggggaaaa tacagcagtg 61 aagccagagg cctggctgtc ctgtggcccc agtcctggcc ctggccgtct gcagcttgtg 121 tgccatgtct caggattcta cccaaagccc gtgtgggtga tgtggatgcg gggtgagcag 181 gagcagcggg gcactcagcg aggggacgtc ctgcctaatg ctgacgagac atggtatctc 241 cgagcaaccc tggatgtggc ggctggggag gcagctggcc tgtcctgtcg ggtgaaacac 301 agcagtctag ggggccatga tctaatcatc cattggggtg gatattccat ctttctcatc 361 ctgatctgtt tgactgtgat agttaccctg gtcatattgg ttgtagttga ctcacggtta 421 aaaaaacaga gttcaaataa gaacattctt tctccccaca cacccagccc tgtctttctc 481 atgggagcca acactcagga caccaagaat tcaagacatc agttctgctt ggcacaagta 541 tcgtggatca aaaacagagt attgaagaag tggaagacac gcctaaacca actctggtga //