LOCUS       AJ000491                 959 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for telethonin.
ACCESSION   AJ000491
VERSION     AJ000491.1
KEYWORDS    19 kDa protein; sarcomeric protein; telethonin.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 959)
  AUTHORS   Valle,G.
  JOURNAL   Submitted (17-JUL-1997) to the INSDC. Valle G., CRIBI Biotechnology
            Centre, Universita di Padova, via U. Bassi 58b, Padova, 35121,
            ITALY.
REFERENCE   2
  AUTHORS   Valle,G., Faulkner,G.P., Deantoni,A., Pacchioni,B., Pallavicini,A.,
            Pandolfo,D., Tiso,N., Toppo,S., Trevisan,S. and  Lanfranchi,G.
  TITLE     Telethonin, a novel sarcomeric protein of heart and skeletal muscle
  JOURNAL   FEBS Lett. 415(2), 163-168(1997).
   PUBMED   9350988
FEATURES             Location/Qualifiers
     source          1..959
                     /db_xref="H-InvDB:HIT000243810"
                     /organism="Homo sapiens"
                     /chromosome="17"
                     /map="q12"
                     /mol_type="mRNA"
                     /tissue_type="skeletal muscle"
                     /db_xref="taxon:9606"
     CDS             11..514
                     /codon_start=1
                     /product="telethonin"
                     /note="19kD sarcomeric protein"
                     /db_xref="GOA:O15273"
                     /db_xref="H-InvDB:HIT000243810.11"
                     /db_xref="HGNC:HGNC:11610"
                     /db_xref="InterPro:IPR015667"
                     /db_xref="InterPro:IPR023111"
                     /db_xref="PDB:1YA5"
                     /db_xref="PDB:2F8V"
                     /db_xref="UniProtKB/Swiss-Prot:O15273"
                     /protein_id="CAA04129.1"
                     /translation="MATSELSCEVSEENCERREAFWAEWKDLTLSTRPEEGCSLHEED
                     TQRHETYHQQGQCQVLVQRSPWLMMRMGILGRGLQEYQLPYQRVLPLPIFTPAKMGAT
                     KEEREDTPIQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM
                     SQEAQRG"
BASE COUNT          196 a          257 c          355 g          151 t
ORIGIN
        1 cggcacgagc atggctacct cagagctgag ctgcgaggtg tcggaggaga actgtgagcg
       61 ccgggaggcc ttctgggcag aatggaagga tctgacactg tccacacggc ccgaggaggg
      121 ctgctccctg catgaggagg acacccagag acatgagacc taccaccagc aggggcagtg
      181 ccaggtgctg gtgcagcgct cgccctggct gatgatgcgg atgggcatcc tcggccgtgg
      241 gctgcaggag taccagctgc cctaccagcg ggtactgccg ctgcccatct tcacccctgc
      301 caagatgggc gccaccaagg aggagcgtga ggacaccccc atccagcttc aggagctgct
      361 ggcgctggag acagccctgg gtggccagtg tgtggaccgc caggaggtgg ctgagatcac
      421 aaagcagctg ccccctgtgg tgcctgtcag caagcccggt gcacttcgtc gctccctgtc
      481 ccgctccatg tcccaggaag cacagagagg ctgagaggga ctgtgacttg ggctccgctg
      541 tgcccgccct gggctgggcc cttcctggct aggactgtgg aggggagctg ctggccatgg
      601 ctgctttgta gtttgcccag agttgggggc taggggaggg gggagccaga ggccaggatg
      661 cctgagcccc ctgagttccc aaagggaggg tggcagagac agtgggcact aagggtggag
      721 agttgggggc cagcacagct gaggaccctc agccccagga gaagggacaa aaggtactgg
      781 tgagggcaag aggtgcctgg gaggagtggc cctgatccag gaaaatgtga ggggaatctg
      841 gaacgctcta ggcagaagaa gctgggaggg agggggaggt gaaaagggca gaggcaagga
      901 tggtggggcc cccagcaccc tctgttagtg ccgcaataaa tgctcaatca tgtgccaga
//