LOCUS       AF152473                2457 bp    mRNA    linear   HUM 14-JUL-1999
DEFINITION  Homo sapiens protocadherin alpha C1 short form protein
            (PCDH-alpha-C1) variable region sequence, complete cds.
ACCESSION   AF152473
VERSION     AF152473.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2457)
  AUTHORS   Wu,Q. and Maniatis,T.
  TITLE     A striking organization of a large family of human neural
            cadherin-like cell adhesion genes
  JOURNAL   Cell 97 (6), 779-790 (1999)
   PUBMED   10380929
REFERENCE   2  (bases 1 to 2457)
  AUTHORS   Wu,Q. and Maniatis,T.
  TITLE     Human protocadherin genes
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 2457)
  AUTHORS   Wu,Q. and Maniatis,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAY-1999) Department of Molecular and Cellular
            Biology, Harvard University, 7 Divinity Avenue, Cambridge, MA
            02138, USA
FEATURES             Location/Qualifiers
     source          1..2457
                     /db_xref="H-InvDB:HIT000071777"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="5q31"
     gene            1..2457
                     /gene="PCDH-alpha-C1"
     CDS             1..2457
                     /gene="PCDH-alpha-C1"
                     /function="cell-cell adhesion"
                     /note="member of the cadherin superfamily"
                     /codon_start=1
                     /product="protocadherin alpha C1 short form protein"
                     /protein_id="AAD43734.1"
                     /db_xref="GI:5456986"
                     /translation="MVGCGVAVLCLWVSCGAAAGQLEYSVPEETERGVAVGNLSADLR
                     LPAAAMSSRNFRFLSSHRELYFGVDLPSGNLVVREPADREQLCRAKAACVLTYDLVLE
                     DPLELHKIRIHVLDTNDNSPLFPAGDVQLHIPEFLTPGARFTLPNAQDDDEGSNGILS
                     YSLSPSQHFRLDMGSRVDGSEYPELVLEKALDREQRATHLLVLTARDGGLPARSGDAQ
                     VTIIVVDTNDNAPVFERSVYRTKVPETAPNGTVLFRVQALDPDEGSNGEVQYSLSNST
                     QAELRHRFHVHPKSGEVQVAASLGPPETLLEAYIEARDEGVFGLASTAKLLVEVTDVN
                     DHAPELDFLTLSNPVPEDAAPGTVIALFSVKDEDLDSNGRVICGMSSAGPFQLTASFD
                     NYYSLLIDGPLDREQISEYQVLITASDSGSPPLSTRRTITVSVADVNDNTPNFPQPQQ
                     ELFVAENNGPGASLGRVFAQDPDLGKNGLVSYELLDVISEGPSASSLVAVESSSGAIT
                     AKTSFDFEQLRGFHFQVEGRDGGIPPRSATVTINLFVVDRNDNYPVILFPLPRNGSVP
                     VEIVPRSARTGHLVTKVVAEDADSGSNAWLSYHISRASDSSLFRISANIGELRTARLV
                     LPTDAVKQRVVVVVRDHGDPPLSSSVTLGVLLSNSVPQLLPDFEDVWEPGGQLSAQNL
                     YLVIALACISFLFLGCLLFFVCTKLHQSPGCCAQSCCRSTEDLRYGSKMVSNPCMTSA
                     TIDVTTVERLSQTYLYRASLGLGSDNNSLLLRGEYNAADLRNLATGVGLNLPISCIQI
                     RNRKGDHANVNAMVSKFYGI"
BASE COUNT          534 a          641 c          672 g          610 t
ORIGIN      
        1 atggtgggct gtggggtggc agttttatgt ttgtgggttt cctgcggcgc tgcagcggga
       61 cagctcgagt actcagtgcc ggaggagacg gagcggggcg tagccgtagg caatctctcc
      121 gcggacttga ggctgccagc ggccgctatg tcctcgcgga actttcgctt cctttccagc
      181 caccgcgagc tctacttcgg ggtggatcta cccagcggca atttggtggt cagagagccg
      241 gcggaccgcg aacagctgtg cagggccaaa gctgcctgcg tcttgaccta cgacctggtg
      301 ctcgaggacc cgctggagct gcacaagatt cggattcacg tcctggacac caatgacaac
      361 tcacctctct ttcctgccgg cgacgtgcag ctgcacatcc ccgagttcct gacgcccgga
      421 gcccgcttta ctctcccgaa tgcccaagat gacgacgagg gaagcaatgg gatactaagc
      481 tacagcctaa gccccagtca gcactttcgc ctggacatgg gatcgcgggt tgacggcagc
      541 gaatacccgg agttggtgtt ggagaaagca ctggatcgcg aacagcgcgc cacccacctg
      601 ctggtgctta cagctcggga cggcgggcta cctgcccgct caggagacgc acaagtcacc
      661 atcattgtgg tggacacaaa tgacaacgcg cctgtatttg agcgctccgt ataccgcacc
      721 aaggttccag agactgcacc caatgggact gtgttattcc gagttcaagc cttggatcca
      781 gatgaagggt ccaatgggga agtccaatac tccctaagca acagcacgca agcagagctg
      841 cgacaccgct ttcacgtgca ccctaaaagt ggggaggtgc aagtagctgc ttcactaggt
      901 ccgcctgaaa cgctcttgga ggcatacatt gaggcgaggg acgaaggtgt ctttggttta
      961 gctagcaccg ctaaactgct ggtggaggtg actgacgtga acgatcatgc ccccgaactg
     1021 gacttcctga ctctttcgaa cccagtacct gaggacgctg cccctggcac agtgattgct
     1081 ctctttagtg taaaggatga agacctcgat tctaatggta gggtcatttg tggcatgtct
     1141 agtgcaggcc cttttcagct gacggcttcc tttgacaact actacagcct gctgattgat
     1201 gggcccctgg accgggagca gatcagtgaa taccaagtcc tgatcacggc ctcagatagt
     1261 ggctcaccgc cacttagcac ccgaaggaca atcactgtgt cagttgctga tgtgaatgac
     1321 aatacaccaa actttcctca accccagcag gaacttttcg ttgctgaaaa caatggccct
     1381 ggggcctctc taggccgagt gtttgcccag gaccccgacc tggggaagaa tggccttgtc
     1441 tcttatgagc tgttggatgt tatctctgaa gggccatcag cctctagctt ggtggcagtg
     1501 gaatcatcca gtggggccat cactgccaaa acttcctttg actttgagca gctcaggggg
     1561 tttcatttcc aagtagaagg ccgggatggt ggcattcctc ccagaagtgc aacagtgact
     1621 ataaacttgt ttgtggtaga taggaatgac aattatccgg ttatcttgtt tcccttgccc
     1681 agaaatggtt ctgtcccagt ggaaattgtg ccccgctctg ccaggactgg acacttggtc
     1741 acaaaagtgg tagcagagga tgctgacagt ggttctaatg cctggctttc ctaccacatc
     1801 tcccgggcgt ctgactctag tctctttaga atttcagcca atataggtga gctccgtact
     1861 gctcgcttag ttcttcccac tgatgcagtt aagcagaggg tggtggtagt ggttcgggac
     1921 catggagacc caccactttc ctcctctgtc actctgggtg tgctgttgag caactctgtc
     1981 cctcagttac ttccagactt tgaagatgtc tgggaaccag gagggcagct ttctgcccag
     2041 aacttgtatt tagtaattgc cttggcttgt atttcctttt tatttctggg gtgcttactt
     2101 ttcttcgtgt gtaccaagtt gcaccagagc ccaggctgtt gcgctcagag ctgctgtcgc
     2161 tctacagagg atctgaggta tggaagtaag atggtttcaa atccttgcat gacatcagcc
     2221 accatagatg tcactacagt tgagagactt tctcagactt atctctatcg ggcctctctg
     2281 ggacttggtt ctgataataa cagtttgctg ttgcgtgggg agtacaatgc tgccgacctg
     2341 cgaaatcttg ccactggggt aggactgaat ttgccaatat cctgtattca gattcggaat
     2401 aggaaagggg atcacgctaa tgtcaatgcc atggtaagca aattttatgg aatttga
//