LOCUS       AF141347                1657 bp    mRNA    linear   HUM 21-SEP-2001
DEFINITION  Homo sapiens hum-a-tub2 alpha-tubulin mRNA, complete cds.
ACCESSION   AF141347
VERSION     AF141347.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1657)
  AUTHORS   Crabtree,D.V., Ojima,I., Geng,X. and Adler,A.J.
  TITLE     Tubulins in the primate retina: evidence that xanthophylls may be
            endogenous ligands for the paclitaxel-binding site
  JOURNAL   Bioorg. Med. Chem. 9 (8), 1967-1976 (2001)
   PUBMED   11504633
REFERENCE   2  (bases 1 to 1657)
  AUTHORS   Crabtree,D.V. and Adler,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-APR-1999) Schepens Eye Research Institute, 20
            Staniford Street, Boston, MA 02114, USA
FEATURES             Location/Qualifiers
     source          1..1657
                     /db_xref="H-InvDB:HIT000071172"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="hum-a-tub2"
                     /sex="male; female"
                     /tissue_type="whole retina"
                     /note="Caucasians; death from trauma"
     CDS             80..1435
                     /codon_start=1
                     /product="alpha-tubulin"
                     /protein_id="AAD33871.1"
                     /db_xref="GI:4929134"
                     /translation="MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGG
                     GDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANN
                     YARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD
                     YGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLD
                     IERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVI
                     SAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAT
                     IKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLD
                     HKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEE
                     Y"
BASE COUNT          402 a          426 c          418 g          411 t
ORIGIN      
        1 cctaagagtc gcgctgtaag aagcaacaac ctctcctctt cgtctccgcc atcagctcgg
       61 cagtcgcgaa gcagcaacca tgcgtgagtg catctccatc cacgttggcc aggctggtgt
      121 ccagattggc aatgcctgct gggagctcta ctgcctggaa cacggcatcc agcccgatgg
      181 ccagatgcca agtgacaaga ccattggggg aggagatgat tccttcaaca ccttcttcag
      241 tgagacgggg gctggcaagc atgtgccccg ggcagtgttt gtagacttgg aacccacagt
      301 cattgatgaa gttcgcactg gcacctaccg ccagctcttc caccctgagc aacttatcac
      361 aggcaaagaa gatgctgcca ataactatgc ccgagggcac tacaccattg gcaaggagat
      421 cattgacctc gtgttggacc gaattcgcaa gctggccgac cagtgcacgg gtctccaggg
      481 cttcttggtt ttccacagct ttggtggggg aactggttct gggttcacct cgctgctcat
      541 ggaacgtctc tcagttgatt atggcaagaa gtccaagctg gagttctcta tttacccggc
      601 gccccaggtt tccacagctg tagttgagcc ctacaactcc atcctcacca cccacaccac
      661 cctggagcac tctgattgtg ccttcatggt agacaatgag gccatctatg acatctgtcg
      721 tagaaacctc gatattgagc gtccaaccta tactaacctg aataggttaa taggtcaaat
      781 tgtgtcctcc atcactgctt ccctgagatt tgatggagcc ctgaatgttg acctgacaga
      841 attccagacc aacctggtgc cctatccccg catccacttc cctctggcca catatgcccc
      901 tgtcatctct gctgagaaag cctaccatga acagctttct gtagcagaga tcaccaatgc
      961 ttgctttgag ccagccaacc agatggtgaa atgtgaccct cgccatggta aatacatggc
     1021 ttgctgcctg ttgtaccgtg gtgacgtggt tcccaaagat gtcaatgctg ccattgccac
     1081 catcaagacc aagcgtacca tccagtttgt ggattggtgc cccactggct tcaaggttgg
     1141 catcaactac cagcctccca ctgtggtgcc tggtggagac ctggccaagg tacagagagc
     1201 tgtgtgcatg ctgagcaaca ccacagccat tgctgaggcc tgggctcgcc tggaccacaa
     1261 gtttgacctg atgtatgcca aacgtgcctt tgttcactgg tacgttgggg aggggatgga
     1321 ggaaggtgag ttttcagagg cccgtgagga catggctgcc cttgagaagg attatgagga
     1381 ggttggtgtg gattctgttg aaggagaggg tgaggaagaa ggagaggaat actaaagtta
     1441 aaacgtcaca aaggtgctgc ttttacaggg aagcttattc tgttttaaac attgaaaagt
     1501 tgtggtctga tcagttaatt tgtatgtagc agtgtatgct ctcatataca attactgacc
     1561 tatgctctaa aacatgaatg ctttgttaca gacccaagct gtccatttct gtgatgggtt
     1621 ttgaataaag tattccctgt cttaaaaaaa aaaaaaa
//