LOCUS AF092878 754 bp mRNA linear HUM 24-JUL-2001 DEFINITION Homo sapiens zinc RING finger protein SAG mRNA, complete cds. ACCESSION AF092878 VERSION AF092878.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 754) AUTHORS Swaroop,M., Bian,J., Aviram,M., Duan,H., Bisgaier,C.L., Loo,J.A. and Sun,Y. TITLE Expression, purification, and biochemical characterization of SAG, a RING finger redox-sensitive protein JOURNAL Free Radical Biol. Med. 27, 193-202 (1999) REFERENCE 2 (bases 1 to 754) AUTHORS Duan,H., Wang,Y., Aviram,M., Swaroop,M., Loo,J.A., Bian,J., Tian,Y., Mueller,T., Bisgaier,C.L. and Sun,Y. TITLE SAG, a novel zinc RING finger protein that protects cells from apoptosis induced by redox agents JOURNAL Mol. Cell. Biol. 19 (4), 3145-3155 (1999) PUBMED 10082581 REFERENCE 3 (bases 1 to 754) AUTHORS Sun,Y. TITLE Alterations of SAG mRNA in human cancer cell lines: requirement for the RING finger domain for apoptosis protection JOURNAL Carcinogenesis 20 (10), 1899-1903 (1999) PUBMED 10506102 REFERENCE 4 (bases 1 to 754) AUTHORS Swaroop,M., Wang,Y., Miller,P., Duan,H., Jatkoe,T., Madore,S.J. and Sun,Y. TITLE Yeast homolog of human SAG/ROC2/Rbx2/Hrt2 is essential for cell growth, but not for germination: chip profiling implicates its role in cell cycle regulation JOURNAL Oncogene 19 (24), 2855-2866 (2000) PUBMED 10851089 REFERENCE 5 (bases 1 to 754) AUTHORS Duan,H., Tsvetkov,L.M., Liu,Y., Song,Y., Swaroop,M., Wen,R., Kung,H.F., Zhang,H. and Sun,Y. TITLE Promotion of S-phase entry and cell growth under serum starvation by SAG/ROC2/Rbx2/Hrt2, an E3 ubiquitin ligase component: association with inhibition of p27 accumulation JOURNAL Mol. Carcinog. 30 (1), 37-46 (2001) PUBMED 11255262 REFERENCE 6 (bases 1 to 754) AUTHORS Sun,Y. TITLE Direct Submission JOURNAL Submitted (16-SEP-1998) Department of Molecular Biology, Parke-Davis, 2800 Plymouth Rd, Ann Arbor, MI 48105, USA FEATURES Location/Qualifiers source 1..754 /db_xref="H-InvDB:HIT000068373" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="3" /map="3q22-q24" /cell_line="HeLa, D98/AH-2, HPRT-" CDS 1..342 /function="growth promotion" /note="redox sensitive, metal binding; expression protects cells from apoptosis induced by redox compounds" /codon_start=1 /product="zinc RING finger protein SAG" /protein_id="AAD25962.1" /translation="MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWD VECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLC QQDWVVQRIGK" BASE COUNT 205 a 155 c 201 g 193 t ORIGIN 1 atggccgacg tggaagacgg agaggaaacc tgcgccctgg cctctcactc cgggagctca 61 ggctccaagt cgggaggcga caagatgttc tccctcaaga agtggaacgc ggtggccatg 121 tggagctggg acgtggagtg cgatacgtgc gccatctgca gggtccaggt gatggatgcc 181 tgtcttagat gtcaagctga aaacaaacaa gaggactgtg ttgtggtctg gggagaatgt 241 aatcattcct tccacaactg ctgcatgtcc ctgtgggtga aacagaacaa tcgctgccct 301 ctctgccagc aggactgggt ggtccaaaga atcggcaaat gagagtggtt agaaggcttc 361 ttagcgcagt tgttcagagc cctggtggat cttgtaatcc agtgccctac aaaggctaga 421 acactacagg ggatgaattc ttcaaatagg agccgatgga tctgtggtct ttggactcat 481 caaagccttg gttagcattt gtcagtttta tcttcagaaa ttctctgtga ttaagaagat 541 aatttattaa aggtggtcct tcctacctct gtggtgtgtg tcgcgcacac agcttagaag 601 tgctataaaa aaggaaagag ctccaaattg aatcacctta taatttaccc atttctatac 661 aacaggcagt ggaagcagtt tcgagacttt ttcgatgctt atggttgatc agttaaaaaa 721 gaatgttaca gtaacaaata aagtgcagtt taaa //