LOCUS       AF087848                 972 bp    mRNA    linear   HUM 06-JUL-2001
DEFINITION  Homo sapiens GABA-A receptor-associated protein like 2 (GABARAPL2)
            mRNA, complete cds.
ACCESSION   AF087848
VERSION     AF087848.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 972)
  AUTHORS   Xin,Y., Yu,L., Chen,Z., Zheng,L., Fu,Q., Jiang,J., Zhang,P.,
            Gong,R. and Zhao,S.
  TITLE     Cloning, expression patterns, and chromosome localization of three
            human and two mouse homologues of GABA(A) receptor-associated
            protein
  JOURNAL   Genomics 74 (3), 408-413 (2001)
   PUBMED   11414770
REFERENCE   2  (bases 1 to 972)
  AUTHORS   Zhang,M., Yu,L., Zhou,Y., Hu,P.R., Xin,Y.R. and Zhao,S.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-1998) Lab of Human Gene Research, Institute of
            Genetics, Fudan University, No. 220 Handan Rd., Shanghai 200433,
            P.R. China
FEATURES             Location/Qualifiers
     source          1..972
                     /db_xref="H-InvDB:HIT000067490"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..972
                     /gene="GABARAPL2"
     CDS             108..461
                     /gene="GABARAPL2"
                     /codon_start=1
                     /product="GABA-A receptor-associated protein like 2"
                     /protein_id="AAK20400.1"
                     /db_xref="GI:13375573"
                     /translation="MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDI
                     DKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDED
                     GFLYVAYSGENTFGF"
     regulatory      950..955
                     /regulatory_class="polyA_signal_sequence"
                     /gene="GABARAPL2"
BASE COUNT          247 a          200 c          227 g          298 t
ORIGIN      
        1 gtcgccgccg tcgctgccgc tgccgctgcc gccgtcgttg ttgttgtgct cggtgcgctg
       61 agctccgcgg ctccgcgagc cggttccgtc cccttcccgc cgccgccatg aagtggatgt
      121 tcaaggagga ccactcgctg gaacacagat gcgtggagtc cgcgaagatt cgagcgaaat
      181 atcccgacag ggttccggtg attgtggaaa aggtctcagg ctctcagatt gttgacattg
      241 acaaacggaa gtacttggtt ccatctgata tcactgtggc tcagttcatg tggatcatca
      301 ggaaaaggat ccagcttcct tctgaaaagg cgatcttcct gtttgtggat aagacagtcc
      361 cacagtccag cctaactatg ggacagcttt acgagaagga aaaagatgaa gatggattct
      421 tatatgtggc ctacagcgga gagaacactt ttggcttctg agggccattg ctgggctagg
      481 tgcaccgtaa ctgcttgtgt atcttgtaaa tagccagcca ttttcagtta ttataccaga
      541 acctcttcac atagacctat tagtgcattt gtaactggat ttatttctta atatattgga
      601 aggttttgtt tccttagact agtaaattat catacagagt tttattttga gtttttcttt
      661 ttgtgcattg tcctcatgcc tgtattctcc aggaaacttg tccttctgga aatcatattg
      721 aatgatattt ctatatcgaa gtgaggtagg tgcggtatta aagtgaaagg gaaggtgatg
      781 catttattct gggttatgct tgaagtgtta gatggctaag tattaaaatt atccaaatta
      841 aatccttagc agtcagaaca cttgcttcac tagaatatgc caactgccaa tcatgttgga
      901 ctgagctaat ttgttcctct ttctgaaact attaaggtaa ataattaaca ataaaaattc
      961 tcttataaag gc
//