LOCUS       AF009225                2273 bp    mRNA    linear   HUM 15-AUG-1997
DEFINITION  Homo sapiens IkB kinase alpha subunit (IKK alpha) mRNA, complete
            cds.
ACCESSION   AF009225
VERSION     AF009225.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2273)
  AUTHORS   DiDonato,J.A., Hayakawa,M., Rothwarf,D.M., Zandi,E. and Karin,M.
  TITLE     A cytokine-responsive IkappaB kinase that activates the
            transcription factor NF-kappaB
  JOURNAL   Nature 388 (6642), 548-554 (1997)
   PUBMED   9252186
REFERENCE   2  (bases 1 to 2273)
  AUTHORS   DiDonato,J.A., Hayakawa,M., Rothwarf,D.M., Zandi,E. and Karin,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-JUN-1997) Pharmacology, UCSD, School of Medicine,
            9500 Gilman Drive, La Jolla, CA 92093, USA
FEATURES             Location/Qualifiers
     source          1..2273
                     /db_xref="H-InvDB:HIT000061954"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..2273
                     /gene="IKK alpha"
     CDS             36..2273
                     /gene="IKK alpha"
                     /note="protein kinase"
                     /codon_start=1
                     /product="IkB kinase alpha subunit"
                     /protein_id="AAC51671.1"
                     /db_xref="GI:2327069"
                     /translation="MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIK
                     SCRLELSTKNRERWCHEIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGD
                     LRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKII
                     HKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGY
                     RPFLHHLQPFTWHEKIKKKDPKCIFACEEMSGEVRFSSHLPQPNSLCSLIVEPMENWL
                     QLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMTSAKIISFLLPPDESL
                     HSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKT
                     VYEGPFASRSLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVSGLKEDYSRLFQGQRA
                     AMLSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLDLERYSEQMTYGISSEKML
                     KAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAEIMGLQKSPYGRRQGDLMESLEQRAID
                     LYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPK
                     VEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAW
                     LPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDW
                     SWLTE"
BASE COUNT          692 a          425 c          544 g          612 t
ORIGIN      
        1 tcgacggaac ctgaggccgc ttgccctccc gccccatgga gcggcccccg gggctgcggc
       61 cgggcgcggg cgggccctgg gagatgcggg agcggctggg caccggcggc ttcgggaacg
      121 tctgtctgta ccagcatcgg gaacttgatc tcaaaatagc aattaagtct tgtcgcctag
      181 agctaagtac caaaaacaga gaacgatggt gccatgaaat ccagattatg aagaagttga
      241 accatgccaa tgttgtaaag gcctgtgatg ttcctgaaga attgaatatt ttgattcatg
      301 atgtgcctct tctagcaatg gaatactgtt ctggaggaga tctccgaaag ctgctcaaca
      361 aaccagaaaa ttgttgtgga cttaaagaaa gccagatact ttctttacta agtgatatag
      421 ggtctgggat tcgatatttg catgaaaaca aaattataca tcgagatcta aaacctgaaa
      481 acatagttct tcaggatgtt ggtggaaaga taatacataa aataattgat ctgggatatg
      541 ccaaagatgt tgatcaagga agtctgtgta catcttttgt gggaacactg cagtatctgg
      601 ccccagagct ctttgagaat aagccttaca cagccactgt tgattattgg agctttggga
      661 ccatggtatt tgaatgtatt gctggatata ggcctttttt gcatcatctg cagccattta
      721 cctggcatga gaagattaag aagaaggatc caaagtgtat atttgcatgt gaagagatgt
      781 caggagaagt tcggtttagt agccatttac ctcaaccaaa tagcctttgt agtttaatag
      841 tagaacccat ggaaaactgg ctacagttga tgttgaattg ggaccctcag cagagaggag
      901 gacctgttga ccttactttg aagcagccaa gatgttttgt attaatggat cacattttga
      961 atttgaagat agtacacatc ctaaatatga cttctgcaaa gataatttct tttctgttac
     1021 cacctgatga aagtcttcat tcactacagt ctcgtattga gcgtgaaact ggaataaata
     1081 ctggttctca agaacttctt tcagagacag gaatttctct ggatcctcgg aaaccagcct
     1141 ctcaatgtgt tctagatgga gttagaggct gtgatagcta tatggtttat ttgtttgata
     1201 aaagtaaaac tgtatatgaa gggccatttg cttccagaag tttatctgat tgtgtaaatt
     1261 atattgtaca ggacagcaaa atacagcttc caattataca gctgcgtaaa gtgtgggctg
     1321 aagcagtgca ctatgtgtct ggactaaaag aagactatag caggctcttt cagggacaaa
     1381 gggcagcaat gttaagtctt cttagatata atgctaactt aacaaaaatg aagaacactt
     1441 tgatctcagc atcacaacaa ctgaaagcta aattggagtt ttttcacaaa agcattcagc
     1501 ttgacttgga gagatacagc gagcagatga cgtatgggat atcttcagaa aaaatgctaa
     1561 aagcatggaa agaaatggaa gaaaaggcca tccactatgc tgaggttggt gtcattggat
     1621 acctggagga tcagattatg tctttgcatg ctgaaatcat ggggctacag aagagcccct
     1681 atggaagacg tcagggagac ttgatggaat ctctggaaca gcgtgccatt gatctatata
     1741 agcagttaaa acacagacct tcagatcact cctacagtga cagcacagag atggtgaaaa
     1801 tcattgtgca cactgtgcag agtcaggacc gtgtgctcaa ggagctgttt ggtcatttga
     1861 gcaagttgtt gggctgtaag cagaagatta ttgatctact ccctaaggtg gaagtggccc
     1921 tcagtaatat caaagaagct gacaatactg tcatgttcat gcagggaaaa aggcagaaag
     1981 aaatatggca tctccttaaa attgcctgta cacagagttc tgcccgctct cttgtaggat
     2041 ccagtctaga aggtgcagta acccctcaga catcagcatg gctgcccccg acttcagcag
     2101 aacatgatca ttctctgtca tgtgtggtaa ctcctcaaga tggggagact tcagcacaaa
     2161 tgatagaaga aaatttgaac tgccttggcc atttaagcac tattattcat gaggcaaatg
     2221 aggaacaggg caatagtatg atgaatcttg attggagttg gttaacagaa tga
//