LOCUS       AB734099                 531 bp    mRNA    linear   INV 05-JUN-2018
DEFINITION  Camponotus japonicus CjapOBP11 mRNA for odorant-binding protein
            11, complete cds.
ACCESSION   AB734099
VERSION     AB734099.1
KEYWORDS    .
SOURCE      Camponotus japonicus
  ORGANISM  Camponotus japonicus
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Holometabola; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Formicinae; Camponotus.
REFERENCE   1  (bases 1 to 531)
  AUTHORS   Ishida,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUL-2012) to the DDBJ/EMBL/GenBank databases.
            Contact:Yuko Ishida
            Research Institute of Luminous Organisms in Hachijojima; 2749
            Nakanogo, Hachijocho, Hachijo island, Tokyo 100-1623, Japan
REFERENCE   2
  AUTHORS   Ishida,Y., Tsuchiya,W., Fujii,T., Fujimoto,Z., Miyazawa,M.,
            Ishibashi,J., Matsuyama,S., Ishikawa,Y. and Yamazaki,T.
  TITLE     Niemann-Pick type C2 protein mediating chemical communication in
            the worker ant
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 111, 3847-3852 (2014)
  REMARK    DOI:10.1073/pnas.1323928111
COMMENT     
FEATURES             Location/Qualifiers
     source          1..531
                     /db_xref="taxon:84547"
                     /mol_type="mRNA"
                     /organism="Camponotus japonicus"
                     /tissue_type="antenna"
     CDS             70..516
                     /codon_start=1
                     /gene="CjapOBP11"
                     /product="odorant-binding protein 11"
                     /protein_id="BAO48209.1"
                     /transl_table=1
                     /translation="MTKENLILICASLIVTQLVVVHCNEENIDWTTVHEELRKLAGNL
                     RKKCTNEISITEDILEDAELGNFPEGDNKLACYFKCVMDKGGVMKKDGKINYKLLSKM
                     MPAAYRHIGQEMLDECRNISGDDKCTIALNFNKCMFRANPVAYFVI"
BASE COUNT          194 a           72 c          115 g          150 t
ORIGIN      
        1 attaataatt ttagacgagt gagaacattt ttgtctaaat acgatttaat tgtgcgtgaa
       61 ataaaaaaaa tgacgaaaga aaatttaata cttatttgtg cctctttaat tgtcacacaa
      121 ctcgtcgtag ttcattgtaa tgaggaaaat atagattgga ctactgttca cgaggaattg
      181 agaaaattag ctggaaattt gcgtaagaaa tgtaccaatg aaattagtat aacggaagat
      241 atactagagg atgcagaatt aggtaacttt ccagaaggcg ataacaaatt agcatgttac
      301 ttcaagtgcg tgatggacaa ggggggagtg atgaaaaagg atggcaagat caactataaa
      361 ctcttgagca aaatgatgcc ggcagcatac agacatattg gacaagagat gcttgacgaa
      421 tgccgcaata taagtggtga tgacaagtgt accatagctc tcaactttaa caaatgcatg
      481 tttagggcga atcctgtggc gtactttgtc atctaaatat tgattatata a
//