LOCUS       CP094528             4005264 bp    DNA     circular BCT 04-APR-2022
DEFINITION  Agromyces larvae strain CFWR-12 chromosome, complete genome.
ACCESSION   CP094528
VERSION     CP094528.1
DBLINK      BioProject: PRJNA820538
            BioSample: SAMN27014742
KEYWORDS    .
SOURCE      Agromyces larvae
  ORGANISM  Agromyces larvae
            Bacteria; Actinomycetota; Actinomycetes; Micrococcales;
            Microbacteriaceae; Agromyces.
REFERENCE   1  (bases 1 to 4005264)
  AUTHORS   Won,M., Kim,S.-J. and Kwon,S.-W.
  TITLE     Mucilaginibacter sp. isolated from the gut of Protaetia brevitarsis
            seulensis larvae
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4005264)
  AUTHORS   Won,M., Kim,S.-J. and Kwon,S.-W.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-MAR-2022) Agricultural Microbiology Division,
            National Institute of Agricultural Sciences, 166,
            Nongsaengmyeong-ro, Iseo-myeon, Wanju-gun, Jeollabuk-do 55365,
            South Korea
COMMENT     Bacteria and source DNA available from Korean Agricultural Culture
            Collection (KACC).
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: DEC-2021
            Assembly Method        :: NextDenovo v. 2.5.0
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 149.1x
            Sequencing Technology  :: Pilon
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 03/29/2022 13:53:43
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.1
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 3,804
            CDSs (total)                      :: 3,747
            Genes (coding)                    :: 3,705
            CDSs (with protein)               :: 3,705
            Genes (RNA)                       :: 57
            rRNAs                             :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                    :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                             :: 48
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 42
            CDSs (without protein)            :: 42
            Pseudo Genes (ambiguous residues) :: 0 of 42
            Pseudo Genes (frameshifted)       :: 14 of 42
            Pseudo Genes (incomplete)         :: 35 of 42
            Pseudo Genes (internal stop)      :: 4 of 42
            Pseudo Genes (multiple problems)  :: 8 of 42
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..4005264
                     /organism="Agromyces larvae"
                     /mol_type="genomic DNA"
                     /strain="CFWR-12"
                     /isolation_source="Gut of Protaetia brevitarsis seulensis
                     larvae"
                     /type_material="type strain of Agromyces larvae"
                     /db_xref="taxon:2929802"
                     /country="South Korea: Jeollabuk-do, Wanju_Gun,
                     Iseo-myeon"
                     /collection_date="2016"
                     /collected_by="Kim Soo-Jin, Soon-Wo Kwon, Miyoung Won"
     gene            join(4004165..4005264,1..1528)
                     /locus_tag="MTO99_00005"
     CDS             join(4004165..4005264,1..1528)
                     /locus_tag="MTO99_00005"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4062 domain-containing protein"
                     /protein_id="UOE44221.1"
                     /translation="MNPARASIRTPDQRLRVFVSSTLRELAPERRAVRRAIEELRLAP
                     VMFELGARPHPPRELYRAYLEQSDIFVGLYAERYGWIAPGEEISGLEDEYRLAPREMP
                     KLVYVKEAAEREPRLVDLLDRIRDDDGAAYVYFADEDELAELVRGDLATLLAERFASA
                     STRAPVWPATGEPIVVETGHVTPPPVPLSELIGRERELAQVLELLRGAARFITVTGPA
                     GIGKSLLGLAVAHEVRDEFPDGVAFVDLAAVTSADRVAAAIAAAVGVHDTGEGGFEQK
                     LQIALRGRRMLLLIDNFEQVIDAGTVLRDLLEELTDVSVLVTSRSLLRVSGEHGVELG
                     PLPLPDPSRIVDRPTELQAASVRLFVARVRAVKPDFELTAENAIDVARVCVALDGVPL
                     AIELAAARARVLPPAELLERLRRRLPLLTDGSRDLPERHRTMRGAIEWSIQLVPESAQ
                     RLFARLGVFAGPFSLEAAEAIAGAGPGADSPDVVADLEALVDASILRQRERGDRAVYT
                     MLGAVREVAHEHLLELPDARAVHDRYAAWFIALSEEAEYALEGVSQQTWVDRLNDDAD
                     NLRAVMRHLLDTRQWTAAAHFAWMLYLYWWVGGHLGEARAWMNEVLDSGEPLDPLTEA
                     IALYFTRAIAFWQWPEASLIPDLRRSAEGFRASGDLPGEGLAYISLGLAQLAAVTPPD
                     PAAAAESLERALASMREAGDTWGEGHALVTIGRIELLQGRYDSALDRFAASLDIAQRR
                     GDRHAEAIAQYHVGWVRLLLGQADEARRRFEINLDLSCRLAHDEGIAYGLEGLTAVAA
                     QAGDAERAGVLMGAAEVLRERTGLYNMRPFIVTSPFVDRVLDGPDAIVFEAARGRGRA
                     LATADAVAVAFQAPDGARS"
     gene            1533..2393
                     /locus_tag="MTO99_00010"
     CDS             1533..2393
                     /locus_tag="MTO99_00010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44222.1"
                     /translation="MTATERDDRVLLPTRALGAVIIPFLTAAVLLLLVLPADTDATFA
                     WTIDPPITAMLLGSAYLGGIWFFAWVVRETHWHRVWPGYPAVVVFATLLGVATLLHLD
                     RFHHGHPSFIAWAALYATTPVLVLAAFLVNRRRDPWAPDRIDVEIPRAWAIALAAAGG
                     VASVTGLVLFAAPEPFLGSWAWPLTPLTARVVGAVLTLPGFVNVWMLRDRRWSSFRWV
                     FQAQLASLAAMLVSLAVRAGEVRWERPAAWGFAAAIAASAIAYTVLVTRMERRRVGLV
                     RAAQQDRMTA"
     gene            2390..3088
                     /locus_tag="MTO99_00015"
     CDS             2390..3088
                     /locus_tag="MTO99_00015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018173165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ThuA domain-containing protein"
                     /protein_id="UOE44223.1"
                     /translation="MSRRAMILSGGGRYADPWHRFDETSARLASLVERAGYGIEVRTD
                     VDAALAGLPDDLDLLVVNAGDPDRPVDDRAPVGSADAVDGDVRVDPAPLAVAVERGIG
                     ILAVHAAAASLRDYPAFDLALGGRWVDGRSWHPELGLAHVHLVGDHPVRAGLLDFDVV
                     DERYSGLRLHDVIEPIAEHEEQGIRHPLVWAREFGESRLVYDALGHDVRSYDSGPHRE
                     LLAQAIGWLGHTSA"
     gene            3126..3479
                     /locus_tag="MTO99_00020"
     CDS             3126..3479
                     /locus_tag="MTO99_00020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013838251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="UOE44224.1"
                     /translation="MIIRIDPASSTPIFEQLVRAVRAEALAGRLAAGDRLPAARELAA
                     SLEVNVHTVLHAYQSLRDEGFVELRRGRGAIVTGAAAELAAVRRHAVDLVEAARERGI
                     TADAVLALVREELAR"
     gene            3476..4624
                     /locus_tag="MTO99_00025"
     CDS             3476..4624
                     /locus_tag="MTO99_00025"
                     /inference="COORDINATES: protein motif:HMM:NF019468.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1648 domain-containing protein"
                     /protein_id="UOE44225.1"
                     /translation="MTRRRPEASAVPPSGASAPDAPASDRAARDRRDRRDRRIVLAVV
                     LWIPLAIIAAGTGILIAWLPRTPDPLVTHWGATGEADGWMPPVANLLTYLGISLGVLA
                     IMAVSAWVSRRQATRTADAPPPSASSAPSPAGAPSAAGAPSPAAATRPAAVFSPGVTL
                     ALAVVFVSLTGLQLDGGVPDGWEVAVVVVIALGLAALAGVATWIVLPAPEAGDDDGEA
                     VAIALRAAIRLAPGERAVWTSVVRAPWPVTALAVIALVLALVPVVLAPSAWLFSLGAV
                     LVIGVLATTTAARVTIDGSGLTVRTLLGLPIGRVRLADAVVARAVDVRPAEFGGWGFR
                     FDARGRRGVVLRGGTAIEVERRGAGPFVVTVPDAETGAALLNGLIARG"
     gene            complement(4649..5923)
                     /locus_tag="MTO99_00030"
     CDS             complement(4649..5923)
                     /locus_tag="MTO99_00030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013883911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="endo-1,4-beta-xylanase"
                     /protein_id="UOE44226.1"
                     /translation="MTTDPVAHRRGETVLTVLGRDGVPLADTDVVVAQTRHAIAFGNI
                     GFDLVDLANGRGAPGDEELGRRFTDLFDTATLPFYWAQFEPVEGRPRTDELRRTAEWF
                     RDRGVAVKGHPLAWHTLAPAWLLGRPVDEVERTLRARIRRDVADFAGLIDTWDAINEV
                     VILPEFDAEPNAITPLAQARGRVPMVRLAVDEARAANAEVRLLLNDFDLSPRYERLIE
                     AVLDAGVRLDAIGLQTHMHQGFRGEAQLVEIADRFARFGLPLHFTETSLVSGDLMPPH
                     IVDLNDWQVDEWPSTPEGEARQADELERHYRALVGHPAVEAITYWGITDRGAWLNAPI
                     GLLRVDGSPKPSYDRLHELVRGEWWLDDTVLRTDADGRVVVRGFAGEYAVRAVGDATD
                     ASDAPDAAAAAFTVARGAAGEASVTLSNGSEA"
     gene            complement(6004..7455)
                     /gene="xylB"
                     /locus_tag="MTO99_00035"
     CDS             complement(6004..7455)
                     /gene="xylB"
                     /locus_tag="MTO99_00035"
                     /EC_number="2.7.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018189876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004856 - xylulokinase activity [Evidence
                     IEA];
                     GO_function: GO:0005515 - protein binding [Evidence IEA];
                     GO_process: GO:0005997 - xylulose metabolic process
                     [Evidence IEA];
                     GO_process: GO:0042732 - D-xylose metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="xylulokinase"
                     /protein_id="UOE44227.1"
                     /translation="MTLVAGVDSSTQSCKVVIRDATTGALVRSGRASHPDGTEVDPQA
                     WWHALQQAIAAAGGLDDVAAVSIAGQQHGMVVLDVEGRVIRPALLWNDTRSAGAARDL
                     IDEVGADAYAARTGVVPVASFTATKLRWLRDAEPEAAARVAAVALPHDWLTWRLRGFG
                     PAGEADAPLGPVLDELATDRSDASGTAYWGADGYDRELLERALGHDAVLPRVVGPADR
                     VGETVAGVVVGPGAGDNAGAALGLDAQPGDVVVSIGTSGTVFAVTERPVADASGTVAG
                     FADASGNWLPLIATLNAARVLDATAGLLGVDHDELGRLALDAEPGASGLVLVPYFEGE
                     RTPNLPDATASLSGLTLASTTRPNLARASVEGLLCGLADGLDAVRGQGVDARRVLLIG
                     GAAQNPAVRAIAAQVFDVPVAIPAPGEYVADGAARQAAWALTGERPGWPVELVAELEP
                     DTRPGIRAAYAAAAGRVADAASAASAASTPALG"
     gene            complement(7899..9092)
                     /gene="xylA"
                     /locus_tag="MTO99_00040"
     CDS             complement(7899..9092)
                     /gene="xylA"
                     /locus_tag="MTO99_00040"
                     /EC_number="5.3.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0009045 - xylose isomerase activity
                     [Evidence IEA];
                     GO_process: GO:0042732 - D-xylose metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="UOE44228.1"
                     /translation="MASAPTRDDKFSFGLWTVGYNGTDPFGGPTRNALDVVHVVEKLA
                     ELGAYGLTFHDDDLFAFGSTDAQRQTQIDRLKQALADTGLIVPMVTTNLFSAPVFKDG
                     GFTSNDRDVRRFAMRKVMRQLELGVELGAKTFVMWGGREGAEYDSAKDVRGALERYRE
                     AVNFLGQHVIDQGWDIRFAIEPKPNEPRGDILLPTLGHAIAFIDSLEHPELVGLNPEV
                     GHEQMAGLNFAAGIAQALYHGKLFHIDLNGQRGIKYDQDLVFGHGDLHNAFALVDLLE
                     NGGPGGVPAYDGPRHFDYKPSRTEDETGVWESAKANMRTYLLLKERAAAFRADPEVQE
                     ALAAAKVDEIATPTLNEGETWESLAADRSAFEDFDANAYLGGKGFGFVRLQQLATEHL
                     LGARG"
     gene            complement(9238..11820)
                     /locus_tag="MTO99_00045"
     CDS             complement(9238..11820)
                     /locus_tag="MTO99_00045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018173133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 3 C-terminal
                     domain-containing protein"
                     /protein_id="UOE44229.1"
                     /translation="MASAAGEASGASALPFRDVTRSTEARARDLLGRLTRDERIAMLH
                     QAAPAIEQLGVGEFRTGCEVLHGVAWLGTATVFPQPVGLAATWDAELLRRVAEVASTE
                     VRAKRAADPLVSLNAWAPVVNPLRHPAWGRNEEGYSEDPHLTAHLATGYCRGLRGDHE
                     RVWRTVPALKHFLGYNNETDRSATSSELSLRTLHEEELPAFREPIEAGMAGGMMLAYN
                     RVNGAPAHTQPELVDEARSWAPGSLAVVSDAGAPTFVVTIQRAQPDPVHAAAALLRSG
                     VDSFTDDDANAAPTIRNVRGALDAGLISDEDVDRAVLRLLELRVRTGEFDGDDDPYAA
                     GPGAIGPGAIDSPAARELAREAAARSVVVLRNEAGALPLRAPASIAVVGPMADAVLTD
                     WYSGTPPYSVGIASALAERYPDAGVDVETGADTVALRAASNGRYVVADESGAVVEAAG
                     DESSSGELPGAALLDVTDWGDGILTLRSHASGRLLTGGSWPMRADASRVGGWVVQESF
                     LRHEHADGTWSLLHRGSGRWVRVVREAGLLVAEAVTLADAERFDARIVRSGLDAVAAA
                     AANADTVVVAVGNDPHLSGRETEDRPHLRLPESAVAVWRAAREAAEHAVLAIVSSYPY
                     VLGDADDAATLVWSSHGGQELGHGIVDVLSGDREPEGRLAQSWPVDESQPGDLFDYDT
                     LRQQATYRHRPGRAAFAFGHGLTYSTVEYERIELVETSAAAPAPTHRHPALDSAPAEG
                     AAAAGASRVTARIAVRNLGDRVAAELVQLYALPDPALPLPTPRRVLVGFAHVRLAPGE
                     TREVELGFALERLAVWDDAVRLDGAPDDWVHAGALRVQPGGYRIAAGPSSDELPVSEL
                     LRVD"
     gene            complement(11835..14180)
                     /gene="yicI"
                     /locus_tag="MTO99_00050"
     CDS             complement(11835..14180)
                     /gene="yicI"
                     /locus_tag="MTO99_00050"
                     /EC_number="3.2.1.177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012877967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004553 - hydrolase activity, hydrolyzing
                     O-glycosyl compounds [Evidence IEA];
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-xylosidase"
                     /protein_id="UOE44230.1"
                     /translation="MKFTDGYWLTKPGLTPLFAVEVDDVRIDPEAGTMTVYAPTTAIR
                     HRGDTLNRPMLTVTFSSPASGVVSVRVQRHAGRVHHGPDFRLAPEPGFRPRVTVDERE
                     GVLESGDLRVRVPRSGPWHVSFEEGDRVLTTSLPRSIGHITATDAPGRALSGVSGTPA
                     AGAGATWVHQQLSIEPGERVYGFGERFGAFAKNGQVVDTWNADGGTASEQSYKSVPFY
                     LTSRGYGVLVGSPDHVSFEVGSEVNSRVQFSVPGETLDYHVIAGPTPKDVLRRYTALT
                     GRPARVPAWSFGLWLTTSFTASYDEQTVTEFVEGFASRELPLSVFHFDCFWMREYQWT
                     DFEWDERTFPDPAGQLARLHDRGLKVSAWINPYIAQRSRLFAEAAERGYLLRRTDGGV
                     WQWDLWQAGMALVDFTNPAARDWYASHLERLLDQGVDSFKTDFGERVPAEGVVWHDGS
                     DPARMHNYYPQLYNEVVFRTIERRRGVGQAVVFARSATAGGQQFPVHWGGDNDSSYLS
                     MAETLRGGLSLAMSGFGYWSHDIGGFEGTPDAGLFKRWLAFGLLSSHSRLHGSHSIRV
                     PWAFDDEAVEVTRRFTELKLRLMPYLAGVAEQAHTEGIPMMRPMVLEFPGDRGTHDCD
                     TQYALGPSLVVAPVFTADGTVEYYLPEGEWTSLLSGEVVEGRRWVAERHGYDSVPLQV
                     RPGTVLPWGAVADRPDYEWADGVTLRCFALPDGFDEVTTVPGLEGPATTFRVRREGAR
                     VIATSDDARAPWALQVGDRVVEADAAGEVVLDLDAEPVGAR"
     gene            complement(14177..16252)
                     /locus_tag="MTO99_00055"
     CDS             complement(14177..16252)
                     /locus_tag="MTO99_00055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018185648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="UOE44231.1"
                     /translation="MSSSNPTGRRAFASLTAERGILFGGDYNPEQWPREVWREDVELM
                     RRAGVNLVTVGVFSWAMLEPRPGARDFGWLDEVLDLLHAGGIAVDLATPTASPPPWLG
                     VRHPEILPVDADGVRLVAGSRNQFSPASRVYREHALAITRDLAARYATHPAVRMWHVG
                     NEFGQLDFGDEAAREFRTWLRARYGTIDGLNEAWATAFWSQRYDDFDEILPPRRMPYL
                     VNPTQSLDFRRYSSDQLLHCYTELRDAIRDTGATQPITTNFMGLFALADYRSWAGEVD
                     VIADDQYPDPADPHSPADIALVQDLMRSLGGGRPWLLMEQAVSSTSWRPHNLPKSPAR
                     ARLDSLQAVARGADGVCFFQWRQSRAGSERFHSAMLPLAGPGTEVFEGVCRQGAELAA
                     LRDVVGTTVTAEVAVLFDWPGWWAGEQPGGLTDRFATLEQVRRWYRELWRRGVAADVV
                     APGDDLTGYRAVLMPHSYVIEPDAATALRDAVAAGAHLAVGPFSGVADARGHLLTGRS
                     PALLRELVGVSGEEWCPLPDGVTALRATGDWAPETTGGIADLTVSILGEKLRSDGAEV
                     LATFAEGLLADRPALTRNPVGRGSARYLGAVPSDDLLAAVIGETLAEAGVRGALPTEG
                     GASAPLLPDGLEAVRRGPLLFLLNHGGEPVSVAVAAETIDLLTDQRTGAAVVVAPGDA
                     RVLNERRTT"
     gene            16314..18695
                     /locus_tag="MTO99_00060"
     CDS             16314..18695
                     /locus_tag="MTO99_00060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018173136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 95 protein"
                     /protein_id="UOE44232.1"
                     /translation="MTLSKQAATELHALRYTRPARRWTDALPIGDGRRGAMCDGRADR
                     VRLWLNDLDAWSGTLSADPLAGVADRGADALAAVRAALDAGDAGEAEHLLQRQQTPWV
                     QAYLPLGHLDVEVTGADADSRSGSPLGEPVGYRRALDLTTGIASHRSKIDGCLVEHES
                     WVDRVTGAIVHRVAADRPVRLRLRLDAPLRARRAPTATADGLEAEWWLPVDVAPGHER
                     PAEPIRYDPAHGRTATVTLTASAGCEASGDGVVTDAAREHLVLLTTRVGAGASVPSSP
                     RARDADPAALRVAHIAAHREQYLRCTLDLPSPPGAADLDTDERVRRAQEHPDPGLAAL
                     AFHYGRYLLMASSQPGGRPLTLQGIWNAELPGPWSSAYTTNINLQMAYWPAEPTGLGE
                     CHEPLLRFVREVAAGPGAAVARDLHGADGWVLHHNSDAWGHAAPVGAGHGDPAWAFWP
                     MGGVWLALHAWEHYAFGGDLQALRESWPALLGAARFARSWIRADDGRVRTSPSTSPEN
                     HYLDADGIARAVDESSTMDVELLRELADVCTAAAHALGVDPEHDEPVVAELAALAAAL
                     PDPRVAADGTLAEWARDLVDAEPGHRHLSHLVGLHPLARITPDRTPALAAAAAASILG
                     RGEESTGWALAWRAAMHARLRDGARVEQQLRLALRPADDQRGDGESGGGTGHEHRGGL
                     YGNLFSAHPPFQIDGNLGLTAAIAEALVQSHDGVLRLLPALPPGWSNGRVHGIRARGG
                     VTVDLHWSEGRILAVELHAARPCRIDVRGPGIATRTRELQPDAITRIEPEGMS"
     gene            18692..19672
                     /locus_tag="MTO99_00065"
     CDS             18692..19672
                     /locus_tag="MTO99_00065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018185649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="UOE44233.1"
                     /translation="MTTIADVAKAAGVSISTVSYVMSGKRTISPETRERVARAIEELE
                     FRPHAGARSLASRATNVIGLQAPLRTGVDVHVVMQIVAGVVREARAHEYDILLLASDD
                     ASGLERAARSSLVDAFLVMDVESDDTRLATISSLAVPTVLIGLPAGADAVTCVDFDFE
                     AAGALAVERFAARGHRRIALIGSPPEVVTRHTSYADRLARGFLHACAERGIEGSIHPT
                     PSGADAARVVDDVLAEHPAVTGLFVHNEGALPHVAEHLRTRSPGQAPELIALCPPEVA
                     HAVGGLSEVIDLPAEEIGAAAARVLGALLAGEASERVNLLEPRILPGTAG"
     gene            19678..20277
                     /locus_tag="MTO99_00070"
     CDS             19678..20277
                     /locus_tag="MTO99_00070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018173138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF624 domain-containing protein"
                     /protein_id="UOE44234.1"
                     /translation="MRIDPENRAIDGLSTFLAFVGLNLLFLLTCLPIVTIGAAVSALD
                     EVTMRFADDERGRPFADYLPAFGRNFGRATLLALCLLVPAAALWFSGMFWLAYPEPLV
                     TALAVIAFLACAYAVAAFLHAMALVAAYRNTFGRTLKNALLLPAAEPVRTLGIVLIPV
                     TLVCLVVLFPPFIVIVATIGCSVGAYAGAFLFRAVHARH"
     gene            complement(20374..22122)
                     /locus_tag="MTO99_00075"
     CDS             complement(20374..22122)
                     /locus_tag="MTO99_00075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018173139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="UOE44235.1"
                     /translation="MKLRKKAAIVVSAAAMVGLLTSCTGTAPSDDRAAISEFPESWDE
                     EITIDVFDGLANYMGVQEGWFAKLVKDKFNMKLNIIAPNVAGGGDTLFNTRVTAGDLG
                     DLIITDKGEKLDELIQGGLVLDSSPYYGAMENAARFDAAVEHLNAASDGTYAFPSAVS
                     SLKPTEPSEGLDPTFGPYVRWDLYKAAGYPELGTLEDLLPALQQMQQLEPTAPNGQKV
                     YALSLFKDWDGNMMNNAKQPITFYGYDEIGFALAKADGSDYQGILDPDGEYFRTLKFY
                     YDANQLGLVDPDSTTQNYDTLFTKYQNGQVLFSFWPWLGQSAYNTEENTTAGKGFMIA
                     PLEDADIFSYGAEAYGGKQVLAIGSKAEDPERIAAFIDWLYSPEGALANNSQTMGAAG
                     PEGLTWEFDGEEPQLTDFGKEVFLEGDAQVPAEWGEGSYIDGVSTLNISAVLPIDTDP
                     NTGFPYSYKFWPSYQELVQTPLSEDWSSKMGGATTTVEYLQSSDQLLVAPGASYAAPA
                     DSSEIETLRNQVKAIVVQYSWQMVFAENEAQFESLKKELQETAAGLGYDQVLEFDLEN
                     AKAQNDARVAIAKEFG"
     gene            complement(22157..23107)
                     /locus_tag="MTO99_00080"
     CDS             complement(22157..23107)
                     /locus_tag="MTO99_00080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018185652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="UOE44236.1"
                     /translation="MTTTTALTSVNPTHTPPKPTRTGRGIVFTTVNAAVFIGLAFLCA
                     YPFYYLIINSVSANDLAALGEVRWWPIGFHLSNYEQVFQLDGLTQATVVTLGRTIIGT
                     AATVLASAFLGFMFTQNRMWGRQFWYRFTIITMYFSAGLIPVFIIMKNLGLTNNFWVY
                     VLPFVVQPFFIILVKTYVESMPASLQEAAEVDGANIVQIFFRIYLPNMTPILATVAIF
                     AAVAQWNSFQDTLIYITDQNLYTLQYQLYMFLNQANSLAQAMANSGGNMAAIADAATT
                     QTPTSIRMTISVIVVLPIIFIYPLFQRFFVKGIMLGAVKG"
     gene            complement(23118..24110)
                     /locus_tag="MTO99_00085"
     CDS             complement(23118..24110)
                     /locus_tag="MTO99_00085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018173141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0016020 - membrane [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease subunit"
                     /protein_id="UOE44237.1"
                     /translation="MTSQVLQELTATELDESPIAEKAARKRARHAGGRRSFGMFACIV
                     PFLVLVFLFSYFPLYGWIYSLYDYKPALGLEGSEFVGLQWFQLLVGSPTQVAQIGQVL
                     LNTLAISFLGIATSILPLGFAVFLNEVKTPWFKNAVQTLTTLPNFISWVLVYMIAFSL
                     FSSSGLVNGVLEDLGLITMPVKFLDTDQNVWLTMALWSVWKGLGWGAIIYIAAISGID
                     QSLYESAEIDGAGRFQRMWYITVPQLMPTFIVLLLLSVANLLNNGMEQYYVFQNAFNK
                     QYIQVLDLYVFNVGMTGNNLSMATAIGMLKSLISVALLFTVNAIAKRVRGQSIV"
     gene            complement(24441..26960)
                     /locus_tag="MTO99_00090"
     CDS             complement(24441..26960)
                     /locus_tag="MTO99_00090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020097900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 3 C-terminal
                     domain-containing protein"
                     /protein_id="UOE44238.1"
                     /translation="MTQTPAVESGDRSHALAPVESVAQISSVLRDADPSLDPRLAALA
                     RRAAADGVVLLRNDGVLPFAADRRIAVFGRAQLDWFAVGYGSGGDVKAPYSWNLLAGL
                     RDVGVQVDDELAAATSAWTAAHRPATSAEWGRWPHHLPEMPVDDELVTTAAARSEDAV
                     VVIGRAAGEARDSLLEPGSYFLTDAESDLLDRVTAAFARTVVVIDAGNVMDLGWLARY
                     GDRIAGVVLAWQGGMEGARAVAAVLAGEIAPSGRLTDTIAATYDDYPSVVGFGDPEAT
                     VYAEDVFVGYRYFETFAPDRVLYPFGFGLDYAEFTQRVVRASTDADRIELEVEVANVG
                     TEHSGRQTVQAYVSKPGTALAQPARELAGFAKTSLLAPGQRERLVLSIDLADLASYDD
                     AGTTGHRDCWVLEPGEYRFAVGTDVRRAEPVASITLDEVRVIREAVEAAAPDPAAPFR
                     RMTLERDADGRAVVGWEPVPTATVDRRERVLDDLPTALEPTGDRGIRLDDVAAGTATL
                     DEFVAQLTLDELALLARGDLVMDSPLGTPGNAGVLGGVSASLRTKGVRPVTAADGPSG
                     IRLSSYASLLPSGTALASTWDPALVRELAALHGQEMVRKGADVLLAPGMNLHRNPLCG
                     RNFEYFSEDPLLTGRLAAAVVAGVQSQGVAACPKHFAANNQEAFRTRHDSRVSQRALR
                     ELYLRGFELCVREAKPLALMTSYNRVNGVWAHYHHDLVTTVLRAEWGYEGCVITDWWL
                     ESAVDPDFPALADNAYRVRAQVDVLMPGGVKTDDGPQAYADDTIVESVARDDGLTLGE
                     LQRGARNVLGLVLALAPVIDARATAAASPRRRCATATDASG"
     gene            27102..28142
                     /locus_tag="MTO99_00095"
     CDS             27102..28142
                     /locus_tag="MTO99_00095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012868276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="UOE44239.1"
                     /translation="MKSDVAGERVTLADVADEAGVSLSTISKVLNGRADVAPATRERV
                     EHVLAERGYRRRGAGRSETRAELIEIVFHELDRIWSMELIDGVEAVAKEHGLSVVLTV
                     SGSRHSPDAEWVEGVMRRRPVGVVLVFSDLAPEFREQLRARAIPFVIVDPAGDPSPDA
                     PSVGSANWSGGLAATRHLIELGHRRIAAITGAEDMMCSLARVDGYRSAMNSAGLTIDP
                     AWIRFGDFHVTGGRDHARALLSGSDRPTAIFAGSDMQALGVLEAARELGLRVPEDLSV
                     VGYDDIPLARWLTPRLTTVHQPLRRMGEEAARLAIRLAETPTGAGAPTPRMDLATSLV
                     VRESTAPPAPGA"
     gene            complement(28435..32073)
                     /locus_tag="MTO99_00100"
     CDS             complement(28435..32073)
                     /locus_tag="MTO99_00100"
                     /inference="COORDINATES: protein motif:HMM:NF012551.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="endo-1,4-beta-xylanase"
                     /protein_id="UOE44240.1"
                     /translation="MQRRTIRRALGLATAAAVAGAGALIGVAPAGAAPTTVNAVDFED
                     GTTGGWTQSGGGAGLLEVVDGPDGGKVLRVNDRAADYEGIQSPLGLFEPGKTYDFSMR
                     VRLADGVAGSPGVRFVLKPAYTWIGNTTVSADAWTTVHDTLTIPAGADPEALQLYIGT
                     GDLSPVAPYSYLVDDIAITTEAAPEGPGTDVLATDFESGLDGWGLRGGSGSTPAVVQL
                     TGPGHESDQAALVTGRASQGDGLGHDVTGLLDPSTTYELSAWVRFADGQPVDDVWLSR
                     ANTVEGATTFSTLAQFDGVTNSGWTQVTARFQGSAAEASQIYFETRWSSADPVGNTSD
                     LLVDDISLVAPGAPTIEDLTPIKDTVDFPVGVAIDSRETAGAASELLLKHFDRVTPEN
                     FMKPEAWYDAEGNFRTVNAESDALMDFAQANDLKVYGHVLVWHSQTPAWFFQDGSGQP
                     LAADDAGKAVLRERLRTHIFDVAGYLAGKYGEFGSDTNPLAAIDVVNEVVSDGGEYAD
                     GLRRSEWFRILGEDFIDLAFEYADEAFNGEFAAEGADRPVTLFINDYNTEQGGKQVRY
                     HALVERLLARGVPVDGVGHQFHVSLAMPVSALEQAIVAFEDLPVTQAVTEFDVTTGTP
                     VTTAKLIDQGYYYRDAFRVFRAHTDDLFSVTMWGLTDGRSWRNSSGAPLVFDDSLKAK
                     PAYYGIVDGELAPRARTANVFQGDVALDGQATASPEWAHLPLIDVEGDARFQLRWEAD
                     HLTVFASVDDASSEASDAVAFTIGDRTWSVDRTGAGDVPAVAVERTGGYDLVAHLPLD
                     AAALGDTLGFDLGVTDGAGDGFGTIAWNSPGELGTLTLVEPVSYVDVVRTADAPVVDG
                     AVDEAWADADPVTTEKQVQGTDGAIATVRTLWKGETLYVLAEVADPIVDVTGSDPWIQ
                     DSVEIYVDPGNAKNGSYRYDDTQIRISAANAVSFGTGDEAFQRARVTSATAEVDGGYV
                     VEAAIQLGDYAGLGTVHGLDFQVNDASNGARTAIRNWADPTGAGYQSTARWGVGGFVA
                     ADDEPGEPGEPDGPTVSLGATSVPAGGTVELELSGFAPDTEVSLVLQNPTVEPVAFAA
                     LLAAPVAAPLAEVALLAAPVALDSVTTDATGSAQLVATIPASVTPGSYELAAVVDGAT
                     LATAALDVTAAADPGTGAGDGTGSGSGTAGAGGLASTGVEVGLWLLLVAGLGTAGGLL
                     VMRRRRTA"
     gene            complement(32270..34648)
                     /locus_tag="MTO99_00105"
     CDS             complement(32270..34648)
                     /locus_tag="MTO99_00105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012868277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 3 C-terminal
                     domain-containing protein"
                     /protein_id="UOE44241.1"
                     /translation="MEHRPWHDTSLPAADRVEALIDALTLDEKLAQLYGVWVGASADG
                     GDVAPNQHEMIGDVDLDALLPNGLGQLTRPFGTAPVDPGVGALSLARTQRRIVEEHRL
                     GIPALAHEECLAGFAAWGATAYPVPLSWAATFDPELIERMSRRIGDDLRRVGIHQGLA
                     PVLDVVRDARWGRVEETMGEDPYLIGTVGAAYVRGLESAGIVATLKHFVGYSASKAGR
                     NLAPVSVGPRELADVLLPPFEMVLREGRPRSVMNAYTDIDGVPTAADAALLTDLLRGV
                     WGFEGTVVADYFAVAFLQTLHGTAGSLAEAAAAALEAGIDVELPTVHAFGAPLREAIA
                     DGRLDVAVIDRALRRVLAQKLELGLLDADWDATPAALRDLADDIDAVRGTIDLDPPAN
                     RALAAEIAERAIVLLHNDGTLPLASGDRTAPARIAVVGPTADDRFAVLGCYAFPTHVG
                     VHHPESGDGIDLPTLLESVRAEFPDAEVTYVTGTSIDGGETDGFADAVAAASAADVVV
                     LALGDRAGLFGRGTSGEGCDAESLALPGAQGALLEAVLDAGTPTVVTLLAGRPYTLGT
                     APERAAGILEAFFTGEEGTRALAGILSGRVAPSGRLPVSVPASAGVHPSTYLASPLAQ
                     RSGVSSIDPTARYPFGHGLTYTSFAWGEVAGDAAAVPTDGEVSVRVRVANTGDREGIE
                     VVQLYLHDPVASVVRPVQRLIGYARVALAAGEAADVRFTVPADLASFTGRDGTRIVEP
                     GELVLGLGRSSADLVGTHRVELTGPVRRVDHTRRLHPEVAVERHSLEASVTA"
     gene            complement(34651..35550)
                     /locus_tag="MTO99_00110"
     CDS             complement(34651..35550)
                     /locus_tag="MTO99_00110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018185644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="UOE44242.1"
                     /translation="MTATTAITTRGAKAAAPRRRAGQGFDWGQPIVYLVALAVAAIAV
                     GPVLYVFISGFRTNPDFFTNPAGMPDPWTADNYVRVLTNPTFWNQVLASTVTALGTTL
                     GVMLFGVMAAFVIARYDFKGRQLLYAMFTTGLLFPLTISILPLTVLLRQLNLFGSWWG
                     LIIPQVAFALPTTIIILVPFLRAIPGELEDAAMVDGTSRIGFFWRIMVPLSMPALMTV
                     GVLAFVGSWNAYLLPLFVLQAGGAGSDSYTLPLGVQFFSTANGQDTTGVLSYTALAML
                     PAILFFTLAEKRIVGGLQGAVKG"
     gene            complement(35550..36536)
                     /locus_tag="MTO99_00115"
     CDS             complement(35550..36536)
                     /locus_tag="MTO99_00115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013599310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="UOE44243.1"
                     /translation="MTALNTAGPAVTAGPAPSRNTKHSARRKARRWGEISLFAGPAVL
                     VYLLFVLLPVILAAFYSFFNWNGLGPLDRFIGLDNYTRLLSDPVFHRSVFNNFFIIVM
                     SLIIQGPLAILVALLMNRPLRFRGLLRALIFVPYVLSEVTAGLAWQILLQSVPPNRWG
                     PFDTLLRSIGVENPPAWLADQDVVMWTMFGILTWKYLGLAIILMLAGLSGVPEELYEA
                     AALDGAGWWKTQWYITVPLLGPTIRIWAFLSIIGALQLFDMVWIVTGGGPLNASSTMA
                     VYMVKNGLNVSQIGFGSAVAVVLFLISLVIALVYQRFALRRDLAGAITGGVR"
     gene            complement(36538..37860)
                     /locus_tag="MTO99_00120"
     CDS             complement(36538..37860)
                     /locus_tag="MTO99_00120"
                     /inference="COORDINATES: protein motif:HMM:NF024808.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="UOE44244.1"
                     /translation="MNRRSTKLVALGATAGLAALALAGCAPAGDGADGSGDTTTITWW
                     HNGTGEPLNSFWEDVASEFEADHPGVNVEVEAFQSEDLQRTLIPNALQAGGDAAPDLF
                     MVWAEGEIKAQVEAGYLKDLSGLTDVVDSVGGAGTGWNVDGKQYGIPFRYGIEGIWYN
                     ADLFEQAGITETPATFTEYSDAINKLAAAGVSPIGVGAGDGWPAAHWWYQFAIKTCSP
                     ESLDKAADTLEFDDPCFVEAGENLKAWMDEFDGDLPFQSNPTSTPAQSVPNSSAGLLA
                     SQTTAMELMGTWHRGEVAKLVPGAPADNPPAPEWLSWMPVPDIEGASGAPGAALGSGD
                     AWGVYVDAPDETLDLLEYVMSEDVQTRFAALGEIPTVAGAEAGITDPVLKQIADGTQN
                     AALVVTWLDTQYGPVIGQAMNDAIVNLMFGDGTPESVPEAMNAAAATL"
     gene            38008..39177
                     /locus_tag="MTO99_00125"
     CDS             38008..39177
                     /locus_tag="MTO99_00125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020665436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family protein"
                     /protein_id="UOE46199.1"
                     /translation="MERSGTFDGVHRRNLSKLLTLVHLEGPLSRARLTAMTGLNRSTV
                     AALAAELADLGLTIERAPDPTNRVGRPSPVVAPSPDVLAVAVNPELDAVTIAAVGLDG
                     RIPVRERVEVDRIVTPDETAALVADAIARWRSAELPGARFVAVGLAVPGLVRADDGMV
                     RFAPHLDWRDVPLPALVEQATGLPAVVGNDATFGVTAEHLFGAGRGVDHIVYLNGGAS
                     GIGGGLIVHGLPVGGAGGYAGEFGWNRPGIADPDDRTAPAGVLEAEVSRARLLAVAGL
                     AHADEPTLAAVLAASDDVEVGAELARQRRILSTALANAVNVLNPSLVVLGGFLATVAA
                     SDPDALHEAVVAQTMPAAAEGLEIRVAALGEDRLLIGAAEAAFADLLRDPIGPGD"
     gene            39375..40646
                     /locus_tag="MTO99_00130"
     CDS             39375..40646
                     /locus_tag="MTO99_00130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019178798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug effflux MFS transporter"
                     /protein_id="UOE44245.1"
                     /translation="MSTASIPIIRPDDLRAPTHPGDRLSARQRLVYVLVLGALTALGP
                     FTVDLYLPAFPVLQQEFGVGPAAVQITLTGTMVGFGFGQLIVGPWSDKVGRRLPLLLA
                     TGLHIAASVAAALAPDIVWLSVFRLLQGFGAAAGGVVAMAMVRDLFGGKPLVKMLSRL
                     ALVNGLAPVLAPVIGSQLLAVMDWRGVFWVLACYGLFVVLAVGFSIRETLPVERRRAA
                     GHSTIGQRYRALFRDRVYLGAAIAGGMTFTGLFGYLSTSSFLFQEVYAFTPQQYGVLF
                     GVNSVGIIIGVQTSSRLMRGRIGPQWILAVTTAVHLAMALTIMALDSAGAGFWGTAVP
                     LFVYITACGFSFPAVQILALANHGAEAGTAASLLGALNFGLAGLISPFIGMLGVGSAV
                     PMAFVQVLASLVAIAALWTLVRPRTVPPLGD"
     gene            40679..41407
                     /locus_tag="MTO99_00135"
     CDS             40679..41407
                     /locus_tag="MTO99_00135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019178800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 family protein"
                     /protein_id="UOE44246.1"
                     /translation="MTGQTVETRVRRFRRRVPIAVGLTAIALAFGLGALIMLRGGGLP
                     MPIDEEWAEEVLTIRGPVGDVLAGFMNWLGGGIVGVILIPAGGAILLVVLGRPWAALY
                     FVVASAVSAAIVQLLKELFGRDRPEDMLVTSDFGSFPSGHVANAATIAVVVGVIAPRA
                     RVWAAGVAYTALMAVSRTYLGVHWVTDTIGGALVGAGAALLVWAVLAGPLERERLAWI
                     ERMSRRNAERAQAHVTPPAGSARS"
     gene            41463..42488
                     /locus_tag="MTO99_00140"
     CDS             41463..42488
                     /locus_tag="MTO99_00140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020098054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="UOE44247.1"
                     /translation="MAATLHDVARLAGVSIKTVSNVINDYPHVRAETRERVEHAIVEL
                     GYTPNLTARNLRSGRTGAIALAIPDLSLSYFAELAAAVIAAAEDAGAVVLVEQTDGDR
                     DREIELLKSPRLKLTDGLIFSPLGMSQEDVAFLDVPYPLVVLGERIFDGPADHVTMRN
                     VEAARAATEYLIAGGRRRIAVVGAHEGELVGSAALRMQGYREALDAAGIPFDPEIIGY
                     TTLWHRSNGATTMRALLDRGAEFDAVFGFNDTLALGAMRVLQESGRRVPDDVAVIGYD
                     DLDEAQYSIPSLTTVHPGQDWIARTAVASLLERIAGNGEASPPRLMLADYRIVERESA
                     PPAAATR"
     gene            42661..43992
                     /locus_tag="MTO99_00145"
     CDS             42661..43992
                     /locus_tag="MTO99_00145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019181810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="UOE44248.1"
                     /translation="MKRKLLAASGVVAVAAAALTGCSAGGSAESCTNEIVNPDATQVS
                     VWAWYPAFEEVVDLFNQNHDDVQICWTNAGQGNDEYTKFSTAIESGSGAPDVIMLEAE
                     VLSSFSIRDALVDLSEYGAADVQGDYTEGAWKDVSSGDAVYAIPVDGGPMGMLYRKDI
                     LDQYGIPVPTTWDEFAAAAKTLKDAGAPGVLADFPPNGRAYTQALFAQAGSVPFDYDN
                     ANPGEIGIDVADQGSKDVLSFWADLADQGLVAVDEAFTADYNTMLVDGTYAIYVAAAW
                     GPGYLQGLEGTDDSAVWQAAPVPQWDASNPVQINWGGSTFAVTSQAKDKEAAAVVAKE
                     IFGTEEAWKIGIEQAALFPLWKPILESDYFRDLEYPFFGGQQINKDVFLDAAAGYAGF
                     TFSPFQNYAYDQLQQEVTAVVVDGSKDASTALDDLQATLETYATEQGFELK"
     gene            44109..45059
                     /locus_tag="MTO99_00150"
     CDS             44109..45059
                     /locus_tag="MTO99_00150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020015992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="UOE44249.1"
                     /translation="MTTQAVDAPASAPQRPAGGPRRRRSGIERRQNVGWLFIAPFLVV
                     FAAFLVFPLVYAFGMSLFSSTLATGTKFVGVDNYVKAFTDPLFLGGMGRVLLYAIVMI
                     PAQLIVAGVAALLLDTLATWLSKASRLLIFAPYAIPVVIGALMWSFLYSPRFGPASTI
                     FDLFGLDAPNFLSSDNIFFSLVNIVTWQWSGYYMIVIYAALRAIDPAIYEAARIDGAN
                     GFQIATRVKIPMISSSMIMVITFALIGTLQFFTEPTVLRSVASGALPADYTPNMYAFA
                     LAFSYSQFNYAATIAFSLGILVFLGSFGFLFLTRKQNGLK"
     gene            45059..46003
                     /locus_tag="MTO99_00155"
     CDS             45059..46003
                     /locus_tag="MTO99_00155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018189335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="UOE44250.1"
                     /translation="MAVLPAATDANTRAMTVADTRALRRQERARRSGTAGGRRIGSHV
                     LLVIMAIYFVVPIWWLFVAATKSTGSLFSSPALWFDDPLAFFANIAGLFEHQGGIYWR
                     WLGNSFLYAFSAGLGATIVAVLAGYGFAKYRFRGRTAVFGMILGSVMVPLTALVIPTF
                     MLLSQYGLINTPWAVILPSLLNPFGVYLMRVYTQDAVPDELLEAARIDGAGEWRTFRT
                     IVVPLLRPAIVTVLLLSVVGTWNNFFLPLAVLTNPDLLPVTVGLNRWLALSNAGAGGE
                     QVWNLITSGAFISVVPLLLSFLFLQRYWQGGLTLGSVK"
     gene            46091..47602
                     /locus_tag="MTO99_00160"
     CDS             46091..47602
                     /locus_tag="MTO99_00160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020098055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-N-arabinofuranosidase"
                     /protein_id="UOE44251.1"
                     /translation="MPTARLTIDPHFTVGRIDRRVFGGFVEHLGRHVYDGIYEPGHPT
                     ADAEGFRQDVIELVKELGVSTIRYPGGNFVSGFRWEDSVGPRDRRPRRLDLAWHSTET
                     NEVGLHEFDDWLAKVGSDLMLAVNLGTRGTLEALDLLEYTNISGGTTLSQRRIDNGRA
                     DAFGVKMWCLGNEMDGPWQLGHRSADDYGKIASQTAKAMRQLDPSVELVVCGSSSAHM
                     PTFGEWERVVLTHTYDDVDYISCHAYYEEKNGDLGSFLASAVDMDGFIETVVATADHV
                     KAVVGSSKQIDISFDEWNVWYIDRFHGVDKIEGIDNWPVAPRLLEDVYSVADAVVFGN
                     LMISLLRHADRVRSASLAQLVNVIAPIMTEPGGPAWKQTTFFPFSITSRLARGEALQL
                     KLDAPTYSTAEYGEVPLVDAVATHDADSGASAVFLVNRSQTEPVTLTIDIASLGDVSV
                     LESHLIADDDVYAKNTLEDRERVTLQTNDTATIAGGELTITLPPVSWTALSLG"
     gene            47578..48672
                     /locus_tag="MTO99_00165"
     CDS             47578..48672
                     /locus_tag="MTO99_00165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009358074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinan endo-1,5-alpha-L-arabinosidase"
                     /protein_id="UOE44252.1"
                     /translation="MDRALARLSRPLARLSRPLARLRRGRAAGVLAAGALLLALAGCA
                     GGGAPQLTGDLMTHDPALAKQGDTWFVYSTGNATVANGNIQVRSSTDGTTWRYAGEVW
                     DAKPEWLREQVEGVTNLWAPELVEHDGTWYLYYSASTFGKNTSVIALATNTTLDPDDP
                     AYEWVDQGPVIASTPADDFNAIDPGVATDDDGTPWMAFGSFWSGIRMVELEWPSGLRA
                     GTAAGHPDASEPDAEPLRLAEPLRLADRGAPPNAIEAPYLVEHDGDWFLFVSRDSCCR
                     AAESTYKIAVGRASDITGPYVDRDGVPLLEDGGTILAETDGSRIGPGGQSVADGMMAL
                     HYYDGDLNGQFQLALVPLEWDADGWPVLRW"
     gene            48698..50077
                     /locus_tag="MTO99_00170"
     CDS             48698..50077
                     /locus_tag="MTO99_00170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018187708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding protein"
                     /protein_id="UOE44253.1"
                     /translation="MTETDATERAGAGRGAGRNWAGNLSYSARRLVRPTSVDELRSIL
                     AEPGPVRALGSRHSFNDLADTDGTLIATDGLPVEFAEVAGDDGSTVAVRVAGGVRYGE
                     LAPLLHEHGLALANLASLPHISVAGAVATGTHGSGDGIGSLASAVRVLTLVTADGEIV
                     TLRRGDADFAGAVVSLGALGVVVSLELDVEPSYEVAQTVFDGPRWDAILADLDAVTAL
                     GTSVSIFTTWQNADVADQLWVKQRMPRATAARPLADPAADEDAPVDETLVAVIASAAA
                     GTEALGATAAAGPRHPIPGAGTEACTTQLGVPGPWFERLPHFRLEFTPSAGDELQSEY
                     LLPRADAVAAIEAVRRLAPRIAPLLQVCEVRTVRADDLWLSMAYGVDVVALHFTWVAD
                     QPAVEALLPDLEAALPATARPHWGKLFALPADELAARSPRWHDFRALRARLDPDRRFT
                     NPFLARVGL"
     gene            50159..51448
                     /locus_tag="MTO99_00175"
     CDS             50159..51448
                     /locus_tag="MTO99_00175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005050625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="saccharopine dehydrogenase NADP-binding
                     domain-containing protein"
                     /protein_id="UOE44254.1"
                     /translation="MRILLIGAGGVGDAIAKIAARRDFFELLVVSDYDESRAQRTVDW
                     IRARHGETVAARFATAQVDASDPDRVADLAREHAATHVMNAVEPKFVPSVFAGALAAG
                     CDYLDMAMSLSEPHPTDPYAQTGVKLGDDQFAQAGDWEQAGRLALVGMGVEPGLSDVF
                     ARYAADHLFAEIDELGTRDGANLVVRDEAGNEIFAPSFSIWTTIEECLNPPVIWEADA
                     GWYTTPPFSEPEVFEFPEGIGPVECVNVEHEEVLLMPRWVDAKRVTFKYGLGEEFIGV
                     LRTLHLLGLDSTAPVRVRGAAAAVSGPVEVAPRDVVAAALPDPATIGPRMTGKTCAGL
                     WVTGTGVDGAPREVYLYHVSDNEWTMREYDTQCVVWQTALNPVVALELLAAGTWAGRG
                     VLGPEAFDAQPFLELMARPESDGGYGQAWGLEDRLAA"
     gene            51445..52326
                     /locus_tag="MTO99_00180"
     CDS             51445..52326
                     /locus_tag="MTO99_00180"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44255.1"
                     /translation="MTDSSTPGAAAAAAAADAEDATAGVVTRAARPDELDAVIARFEA
                     TWGAGTGPDRSLLRAAGYAGATVLVAVPATPGTDAPGRDAPGTDAPGTDAPPPASTVA
                     SGPIVGAAFGFLGWAGGIHLHSHMNAVDPAHRGRGVGVALKLRQRAVCLAHGVGEIRW
                     TYDPLIRRNARMNLVRLGAEVGAYLPDFYGELRDAINLDDRSDRFEVRWRLDSPRVRR
                     ALERRPQPAWHADGEGLALVADFEAVRGGAPDIARELRERSRVAFAAAFADGLRPELD
                     ARGDYVFTADDPDLEAR"
     gene            52400..52564
                     /locus_tag="MTO99_00185"
     CDS             52400..52564
                     /locus_tag="MTO99_00185"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44256.1"
                     /translation="MSPRSSIQVRVRPVPVVAWAAVWCAAAAVVGGLWSATAQPAATD
                     VPAGVSSADR"
     gene            complement(52617..53453)
                     /locus_tag="MTO99_00190"
     CDS             complement(52617..53453)
                     /locus_tag="MTO99_00190"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44257.1"
                     /translation="MSAAYPDARAWAQDQSLANVPTLARLEAFAFQAHPEIVESFGAE
                     GRSLAPFLRRPRRSPTRLLRNALMLLTAIVVLVAPILGVAIYADAPPYLAPTAEPVAA
                     PIAVPISSISFAVAALTQAVACVVWLRSGARRSIPLLTGAAATAVLAGFASVGLPRVA
                     ARDGFELGGWIVPVWVALVVATAVALALVMRLGVRPPANADAGPDPAPIASTVSDREH
                     ARMLVRRLPADERRLLQQDRDDALRILAARGLLDDDEVQRALAADLGTLFTLDPIRTP
                     AP"
     gene            complement(53498..54361)
                     /locus_tag="MTO99_00195"
     CDS             complement(53498..54361)
                     /locus_tag="MTO99_00195"
                     /inference="COORDINATES: protein motif:HMM:NF016533.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase"
                     /protein_id="UOE44258.1"
                     /translation="MSSVGPSSPGRRAEGALLAKWMLRHDGEPLTTASSRLIPVRTAD
                     GEPAMLKLAHVEEEERGAHLLAALDGHGAARVLRLEGAAALLERATGHGDLARLPAQG
                     RDDKATRIMCRAAQRLHDASRLVFDASDPPELIDLRTWFRELFARADAQSALHRRGAD
                     LANALLDDGPEPSVLHGDVHHGNVLDFGARGWLLIDPKALVGDALFDFCNLLCNPSLE
                     FALRPGRLERQFAVVVHSARLTVDGAARLGHWLVAWCALSSTWFEIADDPGRAAQVAA
                     IGERAVAAGLG"
     gene            complement(54358..55260)
                     /locus_tag="MTO99_00200"
     CDS             complement(54358..55260)
                     /locus_tag="MTO99_00200"
                     /inference="COORDINATES: protein motif:HMM:NF024242.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="UOE44259.1"
                     /translation="MSTQGDRYWRARAGAPRSRGVLVAGLGAPTVVEAAPGAPPTAEE
                     PVRMPRIAPHDALAGLVRHYWIPRWRLPPGRAATQRVLEYPSANLVVEPGTRAAVHGP
                     SIGLAERTLEGEGHAFGVALQPGVAPLLTGRPAREIVGRVVPVPSLDGLSRTVADAVG
                     AGLDHAAVETFERWLAARDLHPSPDARLVRTVIAQAEDDRSIVRVEQLAAFTGVGVRR
                     LERLVREQLGLTPRWLIRRYRLQEAATRLAASDPLDRAGTLADLAAELGYADQAHFTR
                     EFRTVIGVPPGRYLREATAGRMDA"
     gene            55361..55867
                     /locus_tag="MTO99_00205"
     CDS             55361..55867
                     /locus_tag="MTO99_00205"
                     /inference="COORDINATES: protein motif:HMM:NF019928.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SRPBCC domain-containing protein"
                     /protein_id="UOE44260.1"
                     /translation="MDTETESTVEFEMTLYVAATPEQVWEAITGDAGNRAVMWGSVLR
                     GDLVPGSRYEYVGPGRDGDETVHVYGDVLQADAPRVLQLTEHPGATYRENHADLVSRM
                     TWRIEPAGDALTRLTFTSDEWSEGHPARVEAGEVWPHLLSSFKSYLETGRALPAPESE
                     PVPESASA"
     gene            55928..56332
                     /locus_tag="MTO99_00210"
     CDS             55928..56332
                     /locus_tag="MTO99_00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013770414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TOBE domain-containing protein"
                     /protein_id="UOE44261.1"
                     /translation="MPQFRISEVAGLLGVSDDTVRRWVDQGVLAAEHDEHGRLVVDGA
                     DAARRAVDLASAADDPSGVARSARNRFVGLVTRVQRDGVMAQVDIQAGPHRVVSLMSA
                     EAVDDLALEVGSLAVAVVKATTVIVETPGGTP"
     gene            56329..57147
                     /gene="modA"
                     /locus_tag="MTO99_00215"
     CDS             56329..57147
                     /gene="modA"
                     /locus_tag="MTO99_00215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017831267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0030288 - outer membrane-bounded
                     periplasmic space [Evidence IEA];
                     GO_component: GO:0031362 - anchored component of external
                     side of plasma membrane [Evidence IEA];
                     GO_component: GO:0055052 - ATP-binding cassette (ABC)
                     transporter complex, substrate-binding subunit-containing
                     [Evidence IEA];
                     GO_function: GO:0015412 - ABC-type molybdate transporter
                     activity [Evidence IEA];
                     GO_function: GO:0030973 - molybdate ion binding [Evidence
                     IEA];
                     GO_process: GO:0015689 - molybdate ion transport [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter substrate-binding
                     protein"
                     /protein_id="UOE44262.1"
                     /translation="MNPNRLVRRAAGAGAALALLAALAGCASSSPTATSAAPEETSDA
                     PALEGELTVYAAASLTAAFDELAAAFEAEHPGVDVLPIVYDGSSTLATQLVEGAPADV
                     FASADERTMATVDDAGLLAADPELFATNTLRIVVPAGNPGGVTAIEDLANPDLQVVLC
                     APEVPCGAASHQLLDLDGVTLTPVSEEQNVTAVLTKVRAGEADAGLVYSTDAVAAGDE
                     VETIVPANADEIVNRYPIAALAAAGNPDVAAAFVAFVLSDEGQALLAEYGFGAP"
     gene            57201..57983
                     /locus_tag="MTO99_00220"
     CDS             57201..57983
                     /locus_tag="MTO99_00220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015881732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0043190 - ATP-binding cassette (ABC)
                     transporter complex [Evidence IEA];
                     GO_function: GO:0042626 - ATPase-coupled transmembrane
                     transporter activity [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE46200.1"
                     /translation="MPPLLLVPAALAVVVLVLPLAALVARVDWSTLAADVTSPEAIDA
                     LRLSLVTGALATIGCLVVGVPLALVIARATPRVAGWLRALVTIPLVLPPMVGGIALLF
                     LLGRTGLVGQWLDAGLGLRLPFTTAAVVIAQAFVALPFLVLAVEGTVRSAGTRYEQAA
                     ATLGAGRWTTFRRVTLPLAAPGLVAGTVLCFARALGEFGATALFAGNAAGTTRTMPLA
                     IYTAFNGSGVGQGAAVALSLLLLVVAIVILVLVRGWRPGSVG"
     gene            57980..59101
                     /locus_tag="MTO99_00225"
     CDS             57980..59101
                     /locus_tag="MTO99_00225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013602585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="UOE44263.1"
                     /translation="MTRGPATSTAAAGGALDARLRLVRDGFDLDVAFAVGAGEVLALL
                     GPNGAGKSTVLALLAGVLRPAAGRIELDGRTLAEASDRSSTFVRPERRRIGLLGQDPT
                     LFPHLTALENVAFGPRAAGTPRRDATALAASWLARVGLDGLAHRRPAELSGGQRQRVA
                     IARALAARPALLLLDEPFASLDVEVVPELRWMLREQLAASGTSAVVVSHDVIDAVVLA
                     DRTAVLERGRIVDTGPTREVLAAPRSPFTAALAGVNLVVGAAAGGTVVAGEATFTGDA
                     AEPLVEGESAAAVFRPSSVVVATRRPERTSLRNVWHDRVTAIEPSPGGGVRLRFGAPP
                     VHADVTAAAVAELELAPGSEAWLAVKAAETSLHPLAPRR"
     gene            59111..61102
                     /locus_tag="MTO99_00230"
     CDS             59111..61102
                     /locus_tag="MTO99_00230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF853 domain-containing protein"
                     /protein_id="UOE44264.1"
                     /translation="MGDDDAVAKAQAAAQAAAEAAQELQRQAQEAIRKAEEAAAAAQA
                     AADAQAAAAQAAADAARESAAPAPDTASAADDSGTDATRASVPESPAGASSGSDATGA
                     SVPESPAPNAPLTAAEAGAVAAGYAFDGTALELGALVNGEADPAVQVRIPIAMTNRHG
                     LVAGATGTGKTRTLQVLAEQLSAAGVAVFAADIKGDLSGLATPGEGSEKLLARTRGIG
                     QDWTPASFPVEFFSLGGIGRGVPIRATVAGFGPLLLSKVLGLNDTQESSLGLVFHYAE
                     DQGLALLDLSDLRAVLQYLVSDEGKGELDALGGLSKATVGVILRELVAFAEAGADVFF
                     GEPEIDTAEFLRVASDGRGIISLLEVPGVADRPALYSTFLMWLLADLFNDLPEVGDLD
                     QPKLVFFFDEAHLLFADASKDFQAQIVRTVRLIRSKGVGVFFVTQTPKDVPGDVLAQL
                     GSRIQHQLRAFTPDDAKALRATVSTYPKSAYDLESVLTSLGTGEAVVTVMNEKGAPSP
                     VAWTRLRAPQALMSPTPDAQIDAAVAASPLQAKYGTPVDRESAGEILTAKLNAAAAAA
                     KAVEDAKAKAAADAEYAKQQAAIEKQRAKEQKAAQAEYDRIMRETAGSRSKSRSRSSN
                     RSTASGGGGSMLEQVLGSKATRDVLTSVVEGIFGTRRRR"
     gene            61149..61823
                     /locus_tag="MTO99_00235"
     CDS             61149..61823
                     /locus_tag="MTO99_00235"
                     /EC_number="2.3.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012878552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008080 - N-acetyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="UOE44265.1"
                     /translation="MTYEIRPYQPADRAAVGEVCVRTAAAGGDARGRYSDDTLMPEVY
                     AWPYVDHQPDLAWVVVRPAADPAPGAGDPDALLRSGDDAVVGYVIGVADTAAFIDWWR
                     REWTPGFIARHPAPGLAPQPAVGYTESDLLRDGADPDRMRNDDLGTHPAHLHIDLLPE
                     AQGHGLGRALIETLRAALAARNVPGVQLGMDPANTNARAFYDRLGFIELPTHRPDRPL
                     LGIATS"
     gene            complement(61845..62354)
                     /locus_tag="MTO99_00240"
     CDS             complement(61845..62354)
                     /locus_tag="MTO99_00240"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44266.1"
                     /translation="MSIGLQVGLLTVPFLLLAAWVLPDPVSRAVIVGFTVALIVAVWW
                     AWVRFRRTEVTASRYGIVETGFLGGVHVVPARSIARIIRLQLYRGASLETSNQLFAVD
                     RDGYCLLRLRGAFWDCESMDEVAAALGVEEEVRPEPVTVSELRRTDARMLYWWERGLR
                     MPGDDGQRR"
     gene            62596..63093
                     /locus_tag="MTO99_00245"
     CDS             62596..63093
                     /locus_tag="MTO99_00245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013772859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MogA/MoaB family molybdenum cofactor
                     biosynthesis protein"
                     /protein_id="UOE44267.1"
                     /translation="MDADASGIRAAVVTVSDRAAAGAREDASGPLAVRMLREAGCRVG
                     DPAVVPDGADSVHGAIETALAGGARLVVTTGGTGIGPRDRTPEGTRPLLERELPGIGE
                     ELRRAPAPGALLSRGLAGVASGASGPALVVNLPGSTGGVRDGVAVIARVLPHAIAQLD
                     GGDHA"
     gene            63090..63530
                     /locus_tag="MTO99_00250"
     CDS             63090..63530
                     /locus_tag="MTO99_00250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019135705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MoaE"
                     /protein_id="UOE44268.1"
                     /translation="MIRIARVTHDVLDVGAHLAAVRSPRTGAVALFVGQVRDHDPAVD
                     GRVVGLDYTAHPDAESMLRGILAPFAEAGTDPDSDPDPIEIAVSHRIGSLDVGDDALV
                     VAVASAHRAEAFAACREIVERIKADLPVWKRQWQHDGASAWVGL"
     gene            63491..64522
                     /gene="moaA"
                     /locus_tag="MTO99_00255"
     CDS             63491..64522
                     /gene="moaA"
                     /locus_tag="MTO99_00255"
                     /EC_number="4.1.99.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015771526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0051539 - 4 iron, 4 sulfur cluster binding
                     [Evidence IEA];
                     GO_process: GO:0006777 - Mo-molybdopterin cofactor
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP 3',8-cyclase MoaA"
                     /protein_id="UOE44269.1"
                     /translation="MAARRSIRMGGTVTGLVDRYGRVHRDLRISLTDRCSLRCTYCMP
                     EDGVPWLAKDNILTTDELERLARVAASLGVTEVRLTGGEPLLRRDVVDVVRRMAAIEG
                     EEGPLEVSLTTNGLRLPELAGPLREAGLARMNISIDTLRPERFLRLTRRDRLDDVLAG
                     IRAAIDEGFAPVKLNAVAMRGENDDELADLLAYAVSIGAELRFIEQMPLDAGHIWSRV
                     RMVEAEEILAALRERFTLTPIGDRGAAPAERWLVDGGPATVGVIASVTRPFCGACDRV
                     RITADGQFRTCLFARTEDDLLAPLRSGAGDDALAEIMRRAISGKLAGHGIDDPGFLQP
                     DRPMSAIGG"
     gene            complement(64583..64822)
                     /locus_tag="MTO99_00260"
     CDS             complement(64583..64822)
                     /locus_tag="MTO99_00260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016464396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MoaD/ThiS family protein"
                     /protein_id="UOE44270.1"
                     /translation="MARVRLFAAAADAAGTEELSLEASDLGSLLAALRARGDDRLAHV
                     LDRSSFLVDGSRTSEPATPLAADALVDVMPPFAGG"
     gene            complement(64822..65073)
                     /locus_tag="MTO99_00265"
     CDS             complement(64822..65073)
                     /locus_tag="MTO99_00265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013772865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF6457 domain-containing protein"
                     /protein_id="UOE44271.1"
                     /translation="MTTDAPTPAELDEWVAQLAPELGLDAADVPTGRVLDLARDVAHG
                     VARPGAPVSAFVVGLAVGRGLDLDEALARVDALLAERRD"
     gene            complement(65070..65789)
                     /locus_tag="MTO99_00270"
     CDS             complement(65070..65789)
                     /locus_tag="MTO99_00270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013839344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NTP transferase domain-containing protein"
                     /protein_id="UOE44272.1"
                     /translation="MTHAPGPSLAALVLAGGRARRLDGADKPGLRVGSARLVDHAVAA
                     ARTLGADPIVVVGPPGIVDADAAVRVVREDPPFGGPVAAIAAGLRELEASAPDLTVLL
                     AADLPRAQAAAALLRPWIDAADRTPDPQEAGAVLVDAGGRDQWLAGVYRTAALRERLA
                     ALREAGASPHGAALGALVGALALARIPDEGESADIDTWDDLDSWRARLGTLEASADPV
                     GPDPAGPDPAGPDPARPEEDA"
     gene            complement(65786..66256)
                     /gene="moaC"
                     /locus_tag="MTO99_00275"
     CDS             complement(65786..66256)
                     /gene="moaC"
                     /locus_tag="MTO99_00275"
                     /EC_number="4.6.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005051425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA];
                     GO_process: GO:0006777 - Mo-molybdopterin cofactor
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic pyranopterin monophosphate synthase MoaC"
                     /protein_id="UOE44273.1"
                     /translation="MSFTHLDSAGRARMVDVTEKAPTVRSATARGLVRCSAEIVRMLR
                     DGAVPKGDVLAVARIAGIAGAKRTAELLPLAHVIGVHGAVVDLEVVDEGVEVAATVRT
                     ADRTGVEMEALTAVSIAALAIVDMVKGVDKSVTIEQIRLVAKTGGKSGDWHRPA"
     gene            complement(66256..67464)
                     /locus_tag="MTO99_00280"
     CDS             complement(66256..67464)
                     /locus_tag="MTO99_00280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013585590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin molybdotransferase MoeA"
                     /protein_id="UOE44274.1"
                     /translation="MITVEAQLARVLAGAAELPHETVPVDAAHGRVLAVDLRSAIDSP
                     RDANSAMDGYALRRADVLGASPDAPVALRVVGEVAAGSGHDPVIAPGEAVRIMTGAPV
                     PADADAVVPIERTADADWAADPVRIADEPAPAAHIRPAGDDLAAGELVLPRGIRLTAR
                     ALASAVGAGVGELEVVARPRVAIIATGDELAEPGAPLARGQVHDSNSLLVAALAVEQG
                     AVAVHRGRAGDAPGALDAEVRRVLEASVRPDLIVLTGGVSAGAHDPVTRLALEFAKVA
                     MQPGKPQAFGRIDGVPVFGLPGNPVSVAVSFELFVRPFLAVLQGLDPTRPTERAIADE
                     AWRTPVGRRQYQPIVAQRVDGVLHVRPASDRGSGSHLVGRLARAEGFAVVPAEVAAIG
                     VGDEVEVMLG"
     gene            complement(67461..68639)
                     /locus_tag="MTO99_00285"
     CDS             complement(67461..68639)
                     /locus_tag="MTO99_00285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013882141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008641 - ubiquitin-like modifier
                     activating enzyme activity [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ThiF family adenylyltransferase"
                     /protein_id="UOE44275.1"
                     /translation="MPLPPLVDPVDALDPDELRRTARQVRLPELGEVGQRRLAAARVA
                     VVGAGGLGSPALLALAAAGVGTIGIIDDDVVDVTNLHRQVVHGTADVGRPKVDSAAER
                     LAALAPQLVVERHMLHLTDENAPAVLGGYDLVLDGSDRFETRYVVSDACADLGIPVVW
                     AAVLGVDAQVSVFWARPPAVDGRDAVEGVTLRDLYPAEPEGGVPTCADVGVLGSLCMQ
                     AGALQATEAIKLITGIGEPLLGRVLVIDGLRARQREVGLRPAADATRSADAPPRPDAA
                     PRPDATTETDAAPAPSPIGHVSAGELRQRLDQVTVLDVREPSERAERAIAGSLHTPLG
                     AVLAGDRTGLDRDRAIVVHCAIGPRAERAAAVLAAEGYRVSVLDGGMQAWAVVEAAAS
                     "
     gene            complement(68838..68925)
                     /locus_tag="MTO99_00290"
     tRNA            complement(68838..68925)
                     /locus_tag="MTO99_00290"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(68889..68891),aa:Ser,seq:gga)
     gene            complement(68923..69019)
                     /gene="ffs"
                     /locus_tag="MTO99_00295"
     ncRNA           complement(68923..69019)
                     /ncRNA_class="SRP_RNA"
                     /gene="ffs"
                     /locus_tag="MTO99_00295"
                     /product="signal recognition particle sRNA small type"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:14.4:RF00169"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00169"
     gene            complement(69101..70060)
                     /locus_tag="MTO99_00300"
     CDS             complement(69101..70060)
                     /locus_tag="MTO99_00300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="UOE44276.1"
                     /translation="MRRDLRVLVTGGSGFLGSAAVRALAEHPSVALVVSGDVREPASR
                     DDLPAGAVFERVDVTDAAGTAEVVARHRIDTVVHLAAIVNPGTVGEDVERRVDVDGTR
                     NVLDAAVAGGVTRIVVSSSGAAYGYHADSPEWLSEDDPIRGNEEFSYSRHKRLVEEML
                     ASYRSSHPSLGQVVLRIGTILGPTVRNQITALWDAPRLLVVRGSDSPFVFAWVDDVVG
                     AIVAGATGDVTGAFNVAGDGKVTVPEIAARLGKKTLVVPAPLLAFGLRVGHALRLTVH
                     GPERVGFLRYRPVLSNERLKTVLGYVPGKTSREAFEAYLATRR"
     gene            complement(70057..71010)
                     /locus_tag="MTO99_00305"
     CDS             complement(70057..71010)
                     /locus_tag="MTO99_00305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter family protein"
                     /protein_id="UOE44277.1"
                     /translation="MNVDDVVVSFAPGSLVILNVVLGFIMFGIALDTSVDDFKAVAKA
                     PKAMLIALVAQIVLLPAVTFGLTLLLNVQGSIALGMILVACCPPGNISQVLTYRSRGN
                     VALSVSMTAVTNVIYIFVLPLNLAFWGGIHPTGREFIEAVSLNGWQMMAEILLIIGLP
                     FALGFALRARFPRFAARVQPYARWISLLALVGFIVAALAGNWAVFVAVLPIVLGVVFL
                     HDAVALGLGYASARIGGLPPRDRKAITFEVGIRNAGLGLGLVFAFFGGLGGMAVVAGW
                     WGVWDIIAGLVVATLWARHSKRRETDAAASVSPSPAPEASA"
     gene            complement(71007..72356)
                     /locus_tag="MTO99_00310"
     CDS             complement(71007..72356)
                     /locus_tag="MTO99_00310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="UOE44278.1"
                     /translation="MHPIAVIGAGPSGLAAARALDRAGIPFEVFEAGDDVGGLWNIDN
                     PRSTVYESAHLISSRTTTEFAEFPMDSTTDYPGHRELMRYFRAFAERFGLRDRIRFGT
                     RVTRVEPVDGDASGASGWLVTTSGPDATEPDATAETRTYSGVILANGTLAEPNVPTFR
                     GEFTGEILHSSRYKRAAQFDGKRVLVIGAGNSGCDIAVDAVHHAASVDLSVRRGYYFV
                     PRYLFGKPSDTLNQGRPLPARLKQAIDSRVLKAFTGDPVRFGFPKPDYRIYESHPIVN
                     TLVLNHLGQGDLRVMPDIDRFDGRTVHFADGRSAEYDLVLLATGYTLDYPFVDRAHLN
                     WTQAAPTLYLNVFPPSFNGLYVLGMIEASGIGWQGRAEQAALVAAYLAAVRDDPAAAA
                     AFRARADAPWPDLTGGYRYLGLDRMSYYVNKDAYRRTVTKLLSSLPSATPLTNGTRP"
     gene            72521..74680
                     /gene="pta"
                     /locus_tag="MTO99_00315"
     CDS             72521..74680
                     /gene="pta"
                     /locus_tag="MTO99_00315"
                     /EC_number="2.3.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016407 - acetyltransferase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acetyltransferase"
                     /protein_id="UOE44279.1"
                     /translation="MAHSIYICSAEGNTGKSTIALGTLDTLARRATRVGVFRPVARST
                     DERDYVLDLLLAHDGVVPIEYDEAIGVDYETVHADPEAALATIVRRFKAVEAKCDAVV
                     IVGTDYTDVGSPTELWFNARIAANLGTPVLLVIGGRVSEGRGRSEQLGFAEPRTPDQL
                     AQLTELAVGELAREHATLLGIVANRADPDRLDEIIGSVRTAARIEAGATGAETADPPS
                     GVHVWAIPEDRYLVAPSMRTIMRAVDGELLSGDDELLNREALGVVIAAMSMENILTRL
                     IEGSVVVIPGDRSEALLGVLTAHSSATFPSISGIVLNGGFPLSETIERLIEGLRAKLP
                     IIRTDLGSYATAVAITQARGTLAAESQRKRDTALALFEQHVDAAALLDLLDVATTDVV
                     TPLMFEYQLLERARQARKHIVLPEGDDDRILRAAATLLKREVADLTILGEEIEVRSRA
                     IGLGLDISRANVVSNHDAVYVAKFAEAYRERRAHKGVTLEQAREKVTDVSYFGTMMVE
                     LGLADGMVSGASHTTAHTIRPAFEVIKTRPDVGVVSSVFLMALADRVLVYGDCAVVPD
                     PTAEQLADIAVSSARTAVQFGIEPRVAMLSYSTGESGSGADVDKVRQATALVRERAPE
                     LAVEGPIQYDAAVDAAVARTKLPGSDVAGRATVFIFPDLNTGNNTYKAVQRSAGAVAI
                     GPVLQGLRKPVNDLSRGALVQDIVNTVAITAIQAAEA"
     gene            74682..75923
                     /locus_tag="MTO99_00320"
     CDS             74682..75923
                     /locus_tag="MTO99_00320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005051295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate kinase"
                     /protein_id="UOE44280.1"
                     /translation="MGIVLVVNSGSSSFKYQLIDVDASRTLASGLVERIGQGEGRAVH
                     KASPEASDRSEASDRSEASEASEWVRELPIPDHTVGFGVMLEAFREHGPSLDDLPPIA
                     VGHRVVQGGARFFEPTVITNLVKINIDELSALAPLHNPANLEGIVAAQRAFPDVPHVA
                     VFDTAFHQTMPPAAYTYAIDRELAAKHRVRRYGFHGTSHRFVSRATAEFLGRPVEEVR
                     TIVLHLGNGASVCAVSGGRSVETSMGMTPLEGLVMGTRSGDIDPAVLLHLQRRAGLDA
                     DGLDDLLNKRSGVLGLGGHADMRDLEQAVDDGDPHATLAFEVYTHRIRSYIGAYAVQL
                     GRVDAIAFTAGVGENSARVREWALAGLEGFGVVLDPERNASRSRGARRISSDASKVEV
                     LVVPTDEELEIARQTQAVVTA"
     gene            76016..76459
                     /locus_tag="MTO99_00325"
     CDS             76016..76459
                     /locus_tag="MTO99_00325"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44281.1"
                     /translation="MTAISNDIGTRRPTGRTPWAAAWEWAARPMRYRAVRAFRVAAEA
                     GDVGRLEAALDPDVRVVVESREPGRSRARVVQGTRDAITVLVHGMAARADRRIVERSV
                     NGQAGLLVTQAGEATALISVDFTGALVSVVWIRVHPDVLRHWNRV"
     gene            76465..78021
                     /locus_tag="MTO99_00330"
     CDS             76465..78021
                     /locus_tag="MTO99_00330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018192490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0016020 - membrane [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b N-terminal domain-containing
                     protein"
                     /protein_id="UOE44282.1"
                     /translation="MPVHAPESRSSLTDRLSHAVRSTAAAERTRATVAELRGRAVPLH
                     WSNLFGVVAMACIVVLFVTGVFLTFFYTPSSEPVVYSGSYAPLRGVEMSKALESTLFL
                     SFEVPGGLLMRQAHHWAGLLLPAALIMQLLVTFFTGAFRRPRQWSWVLLFLVFLMALL
                     AGWSGYALPDDLLSGTGLRIVEGIVLGIPVVGTWLSALLFGGEFPGQIIEHLAPVHIL
                     IAPAGLVLFLALRIRLAFRHGPAQFAGPGRTEGNAVGLPLLPQLAVRAGALFLIVVGL
                     ILGFAATVTVAPVWLFGPSSPADASAGSQPDWYTGFLDGALRLVPPGWEVEWFSRTWT
                     LAVIVPLLVVGVFLALVAVYPFLEAWITGDRREHHLLDRPRNAPGRTGIGVAAIVFYG
                     ALWGAASADLIATHFQVGLEATIWMFRVLVVAGPLVGFDVARRVCLALQRKDRELVLH
                     GYETGRIVRLPGGEYAEVHAPLTEEERWRLIDRGTAPERPRGSRIRGALFGLFFEDRL
                     AAPPRPPLPE"
     gene            complement(78128..78508)
                     /locus_tag="MTO99_00335"
     CDS             complement(78128..78508)
                     /locus_tag="MTO99_00335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018187884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraR/DksA C4-type zinc finger protein"
                     /protein_id="UOE44283.1"
                     /translation="MSMTRSFTTSRIEKFERLLRAEEAEAESRLAEHREGISEVRAAR
                     SDASADDEHDPEGPTMTQEWSQRSAVLADAEHELADVRRALARLAEGSYGVCERCGKA
                     ITVARLEARPTATLCIDCARLIVH"
     gene            78636..81059
                     /locus_tag="MTO99_00340"
     CDS             78636..81059
                     /locus_tag="MTO99_00340"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010205606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0009360 - DNA polymerase III complex
                     [Evidence IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0003887 - DNA-directed DNA polymerase
                     activity [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_process: GO:0006260 - DNA replication [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma and tau"
                     /protein_id="UOE44284.1"
                     /translation="MVTALYRRYRPETFAEMIGQSQVTEPLMTALRTDRVNHAYLFSG
                     PRGCGKTTSARILARCLNCVEGPTDSPCGTCPSCVELSRSGGGSLDVVEIDAASHGGV
                     DDARDLRERAIFAPARDRYKIFIIDEAHMVTSGGFNALLKIVEEPPEHVKFIFATTEP
                     DKVLGTIRSRTHHYPFRLVPPAPMLEYVQQLCDDEGIAVEPGVLALVVRAGGGSPRDT
                     LSLLDQLMAGSEGSTIDYERAVALLGYTHGALLDEVVDAIGANDAAAAFAAADRVVQT
                     GQDPRRFVEDLLERLRDLIVVAASSPEAAAAVLRGIPADELARMGSQATLFGAAELSR
                     VADLVSQTLTEMTGATSPRLHLELMLARVLVPAIDDSARGALARVERLERRVGVDGAP
                     SSAAGRVSDAPPVAAAPPAPVEPVAVAGADAAPPAATASDVSAPASSAPTPSAPTPSA
                     PSAQPGPATTPRPAPVGPVTLAQVRDAWPEVLALLQRTKRSAWMVAFTAQVREYRDGD
                     VLVLAFPSEADVASFRGSPGNSVSELLRNAIAEVLGVRVKFIAKAEGPGEPAAAEASV
                     APPAEPAASAPAETSPAPAAAEPASAASAASSTRAETGSSSRGAPDGGAPAGAPAGKA
                     PAGNAPAGAASAGRAPAGAASAGAAPAGATPAGATPARRAPAGAAAPARGAGSSSAVV
                     AGAVSSWATVAIPTDPPEHAEPIGAGSGPVASAPATEAATSSTATATAVRDAPDEVPS
                     DADAPPEDDEPPFDPGPPPEVVIDAAPAPVAEPRGVQRYGEAVVREVLGARFLEEVEV
                     PGTGFGERR"
     gene            81062..81658
                     /gene="recR"
                     /locus_tag="MTO99_00345"
     CDS             81062..81658
                     /gene="recR"
                     /locus_tag="MTO99_00345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012297640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0006281 - DNA repair [Evidence IEA];
                     GO_process: GO:0006310 - DNA recombination [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination mediator RecR"
                     /protein_id="UOE44285.1"
                     /translation="MYEGIVQELIDELGRLPGIGPKSAQRIAFHIVQTEHFDVTRLAE
                     ILLEVRDKVRFCEICGNVSQEVTCSICRDPRRDPTLICVVEEAKDVVAIERTREFRGL
                     YHVLGGAISPIDGIGPDQLRIRQLMQRLADGTVREVIIATDPNLEGEATATYLSRMLT
                     TLEIAVTRLASGLPVGGDLEYADEVTLGRAFEGRRAVG"
     gene            81833..82192
                     /locus_tag="MTO99_00350"
     CDS             81833..82192
                     /locus_tag="MTO99_00350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003805714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="UOE44286.1"
                     /translation="MPSRAAEWVAGYIRAWETNDPADIAALFSDDAVYLTAPDAKARR
                     GRDEIVAGWLEDRDESGTWAFDWRILHETLELALIQGRTEYPADRDYLNLWIIRFGDD
                     GRAREYTEWYMPRPHGA"
     gene            complement(82221..82712)
                     /locus_tag="MTO99_00355"
     CDS             complement(82221..82712)
                     /locus_tag="MTO99_00355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017829554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44287.1"
                     /translation="MGELTDAWSEFNVAMLGATAALAGLVIVAMSVNIAEIMKAPSLP
                     ARAAAALAALMAAIIVTAVGLVPDQPVVAYGVEVLFAGLLAAVFEYRATRLIYAQGGE
                     FGPRWAKAAVGWLPVTLFLLGAVLVFAGSPAAALGCLAAASILAIGSAVLHAWIVLVE
                     VLR"
     gene            82869..84143
                     /locus_tag="MTO99_00360"
     CDS             82869..84143
                     /locus_tag="MTO99_00360"
                     /EC_number="2.7.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013585733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004072 - aspartate kinase activity
                     [Evidence IEA];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="UOE44288.1"
                     /translation="MSLIVQKYGGSSVADAESIKRVAKRIVETRKAGNDVVVAVSAMG
                     DTTDELLDLANDVTPIQAPRELDMLLSAGERISMALLAMAIKAMGHEARSFTGSQAGM
                     ITDATHGAARIVDVTPVRLQEALDDGAIVIVAGFQGFSRESRDITTLGRGGSDTTAVA
                     LAAALNADVCEIYTDVDGVFTSDPRVVKRARKLDRITSEEMLELAASGAKVLHIRAVE
                     YARRHGVTLHVRSSFNNSEGTIVYDPSRSPEGAAVEDSVIAGVAVDLSEAKITIVGVP
                     DKPGAAAAIFKIVANANANVDMIVQNVSAAATGRTDISFTLPKSDGEKALSALGSVQD
                     QVGFESLQYDDQIGKLSLVGAAMRSASGVSAKLFEALYQAGINIEMISTSEIRISVVT
                     RADSVHDAARAVHAAFELDGDTEAVVYAGTGR"
     gene            84254..85309
                     /locus_tag="MTO99_00365"
     CDS             84254..85309
                     /locus_tag="MTO99_00365"
                     /EC_number="1.2.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010205612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004073 - aspartate-semialdehyde
                     dehydrogenase activity [Evidence IEA];
                     GO_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     GO_function: GO:0051287 - NAD binding [Evidence IEA];
                     GO_process: GO:0008652 - cellular amino acid biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate-semialdehyde dehydrogenase"
                     /protein_id="UOE44289.1"
                     /translation="MGNGVNIGVVGATGQVGAVVRRLLEEREFPVASIRYFASARSAG
                     TTLPWKGEDVVVEDAETADPTGLDIAIFSAGGATSKAQAPRFAAAGVTVIDNSSAWRM
                     DPEVPLVVSEVNPHAIDEAVKGIIANPNCTTMAAMPVLKPLHEEAGLERLVISTYQAV
                     SGAGLAGGEELYQQARAAVEQDPRSLVHDGSSVSFPDAEKFPRTIAFDVVPLAGSIVD
                     DGDLETDEEKKLRNESRKILELPGLRVAGTCVRVPVFTGHSLSIHAEFANDISPERAA
                     EILQDAPGVVLSDIPTPLQAAGTDPSYVGRIRRDQSAPEGRGLVLFVSNDNLRKGAAL
                     NAVQIAELVAAKLPAAV"
     gene            complement(85407..85799)
                     /locus_tag="MTO99_00370"
     CDS             complement(85407..85799)
                     /locus_tag="MTO99_00370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018171143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0019239 - deaminase activity [Evidence
                     IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="Rid family detoxifying hydrolase"
                     /protein_id="UOE44290.1"
                     /translation="MPKTAVTLSNAPKPAGPYSHGVVANGFLFTAGFGPQDPATGQVV
                     EGGVAEQTRQVLRNIGAVLAEHDLTFDDVVKVTAHLEDLADFAEYNTAYAEFFSEPFP
                     VRTTVGSRLANILVEIDVVAALPQPTGL"
     gene            complement(85878..87443)
                     /locus_tag="MTO99_00375"
     CDS             complement(85878..87443)
                     /locus_tag="MTO99_00375"
                     /inference="COORDINATES: protein motif:HMM:NF019581.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase family protein"
                     /protein_id="UOE44291.1"
                     /translation="MRVLIAGVVAVDGEASASDPVDVVVDDGRIAAVTARGEASDRAV
                     DVRIDGGGRMLVPGFVDAHSHALGRLGDPDVQLGLLRQGITTVIGGQDGVGVAPGDGG
                     YASEYFAAIDGPHPGYPGGGVGELLAALDGASPVNGAYLVPAGTVRFEVMGRSTDAAG
                     PRELAAMRRLVADGLADGAVGLSTGLDYVPGRFASTDEMTELAREVAAVGGVVASHLR
                     GGYESGSAEGVAELAAIARGSGAAVHVSHFHAEPEIVTGLMDALRDDGVDATFDAYPY
                     TRGCSLLSMPLLPPDLSVRPTGEVVAAIADPVVRARLLDEWFPSVVEYPSLGPDWPSM
                     LTFGHIAAPAYDWAHGRTIAAAAGRAGTTPAELVLDVLAAARLEVNVVMAVRSDRSDT
                     HLARILAHPAAIGGSDGIWVGKHPHPRARGTFARYPGLLVDELGWGGAAALCSTRAVD
                     RFGLGDRGRVRVGAVADLALVDPDRIADRATYEHPLAVADGIDDVLVAGVPVLRHGEL
                     TGATPGRGIRHRR"
     gene            complement(87443..88687)
                     /locus_tag="MTO99_00380"
     CDS             complement(87443..88687)
                     /locus_tag="MTO99_00380"
                     /EC_number="5.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018779375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="UOE44292.1"
                     /translation="MPLSVADLDDIRISPADTGLPARAAGLTVGEFLDTEPTLDEFWT
                     PLLVLDDAALRANARAIQSWCDERGLELMPHGKTTMAPALWRLQLDAGATGLTLATPG
                     QVRTARAFGVASVMLANALVAPAALAWAAAELADPGFELRVWADSIDTVDAMETGLGG
                     LGDLPRPIDVLVELGAPGGRTGARTLDEARRLAERIAASPVLRLAGTAGYEGALGHDR
                     STGAVAAVRGYLADLVRLHETIAGLADGDLLLTAGGSAYLDFVAEAFAAPAAQTPGTR
                     RVLRSGASLVHDEGFYRGISPIDDRLTPAMRGLARVVSHPEPGLALLDGGKRDFPYDE
                     GLPVPLTLAGASATALNDQHTFLRAASGARDATGALDVAVGDVVELGLSHPCTAFDKR
                     RLIPVVERFGSDRVVALVRTFF"
     gene            88907..90337
                     /locus_tag="MTO99_00385"
     CDS             88907..90337
                     /locus_tag="MTO99_00385"
                     /EC_number="1.1.5.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008924 - malate dehydrogenase (quinone)
                     activity [Evidence IEA];
                     GO_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="malate:quinone oxidoreductase"
                     /protein_id="UOE46017.1"
                     /translation="MSATLGSLLSRLQPDWSIRVYERLGEVAQESSNAWNNAGTGHAA
                     LCELNYMPEGKDGSVDPAKAVSINEQFQISRQYWAHLVSTGALPEPNRFINSTPHMTF
                     VHGAKNIEYLRKRVDALKDQPLFPGLEYTERQDEIAEWTPLLAKKRNPKQKVAATRIA
                     AGTDVDFGALTRFLFDDLKARGGEVVTDTQVTWLKRQKDGAWKLKLRRLVGNTPAEVR
                     ARFVFVGAGGGALALLQHSGIPEIKGFGGFPISGQFLRTTNPKLVAQHRAKVYGKAAV
                     GAPPMSVPHLDTRVVDGETALLFGPYAGFTPKFLKRSTWFDLPFSVRAHNLGVMLQVA
                     FRNFDLVKYLVGELMATREKKLDALRQFMPTAKREDWELITAGQRVQVMKRDGDKGGV
                     LQFGTEVITGADGTIAGLLGASPGASTAAPIMLDVLQRCFPDRFADWEPTLREMIPSY
                     GTKLSDDPKAAAASLAETARVLQLQA"
     gene            90422..91132
                     /locus_tag="MTO99_00390"
     CDS             90422..91132
                     /locus_tag="MTO99_00390"
                     /EC_number="4.2.1.96"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018772607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0006729 - tetrahydrobiopterin biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="4a-hydroxytetrahydrobiopterin dehydratase"
                     /protein_id="UOE44293.1"
                     /translation="MDMLTGDRIAAAGLADWRKLGQGVHARYLVDGFSTAARFVVAVG
                     EAGDALGHHPRVSIGTGHVDLEAVSDDAIYRDDDGTEYVVEWVTQQDVDLARRITEIA
                     AELGLVADPASVSEIELGLDTARSATVAPVWAALLTGDASSQGRGTPSDEIRDATGRV
                     PNLWFGDGDDREASRQRFHLEVYVAPDVAEQRIAAALAAGGTVVDDREAPGLTVIADQ
                     DGNEGVVCVDVSAAPPVE"
     gene            91421..93187
                     /locus_tag="MTO99_00395"
     CDS             91421..93187
                     /locus_tag="MTO99_00395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013772842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="UOE44294.1"
                     /translation="MAVRLSHSDHLRADGLSVAYGDRRVFSDLDLTVSPGQRLGLIGE
                     NGVGKSTLLALLAGTSADQAVVDGRLARPERTGLLLQEPPYRPGDRIGEVLERALAEV
                     RAIERELDAAASALGDPGNADDDGEAAAAASARYQAALDAAERAEVWSAPARRDELLE
                     GLGISGIDPDRTVGEVSGGQRSRFALAALLLAAPDALLLDEPTNHLDDATAAFLETRL
                     RAWRGPVVFASHDREFLDRVATGLVDLDPGRAGALALARTGSGEGPDGLSPSDGLASA
                     GGQVFGGSFSEFLRVKADERDRWQRQYEAEQDELRRLRLAAADTARQVSHGRGPTDND
                     KFIAKFKHSRTDQAVSRRVRNAEVRLATLEREQVRKPPAPLEFAGIPSGAHALGEASG
                     QLAQVTDASVGDRLVIGTLAIAPETRLLVTGANGAGKSTLLGLLAGRVAPDRGTVTLR
                     KGLRVGLLEQDVRFADPDASPRTLYARTVGERRAEQVPLSGFGLLAPRDLDRPVGVLS
                     TGQQRRLALALVIARPPHVFLLDEPTNHLSLGLATELEEALGGYPGAVVIASHDRWLR
                     RRWAGEELRLDAGRVAGASVAA"
     gene            93254..93481
                     /locus_tag="MTO99_00400"
                     /pseudo
     CDS             93254..93481
                     /locus_tag="MTO99_00400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018189926.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
     gene            93506..93643
                     /locus_tag="MTO99_00405"
                     /pseudo
     CDS             93506..93643
                     /locus_tag="MTO99_00405"
                     /inference="COORDINATES: protein motif:HMM:TIGR01445.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            94051..95397
                     /locus_tag="MTO99_00410"
     CDS             94051..95397
                     /locus_tag="MTO99_00410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012037590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44295.1"
                     /translation="MVGIRTAQRAHVETIESLIAWPDARSAGWDAGFLSGVFDAEGSC
                     SGGILRFSNSNEEILTSIERGLARFGLASIRDPVRLNGVANIRLLGGLPARSAFFGIV
                     QPAITRKLSLIGAAVKTVADLRVVSIEPIEGGSQQLVDITTTTGDFIAEGVVSHNCFA
                     RPTHQYLDLDAGDDFDRQIVVKVNVADVLRTELARPSWGHDPVALGTNTDPYQRAEGR
                     YRLMPGIIDALASSGTPFSILTKGTLLRRDLPLLTDASQQVPIDLAMSIAVYDDDLQR
                     SVEPGTPSTDARLATVTAARDAGFDCTVFLMPILPYLTDTRAHLDDALRRAKAAGATG
                     VIHSALHLRGAVKPWFLQWLEREHPELVPKYRAMYPGAAAYAPKAYRDWLAERIRPLI
                     RAHGLVRVREDPATGGVRFTARSAGARIGRPGAPGLAPPAAGAVGPAAHDTAPTLF"
     gene            95557..96747
                     /locus_tag="MTO99_00415"
     CDS             95557..96747
                     /locus_tag="MTO99_00415"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44296.1"
                     /translation="MSRAFARAGHAAALVCVAVAGIVGLVVAIGAVEPRGLIAFGVAL
                     AFAGLIGLIDLRPTITNTLVYLAGGTAIVFAAAVLVMSRDDLFTDSNNVLLSLPRTAL
                     ILVGGAGIGTGIAVVWASLGWALGEAVVFVACTIVGGAWVINVPSLLVLLMLVAIRSF
                     DGLARRSQRQRAIGLARAGRQARELALRHEYELRATARLHDTVLGHLVAISDAGSGPV
                     SDRLRAGIRHDLGLVIGRDWAVDRRGESAPTATVGDALPPELLPLAFTAMADASLRVR
                     VTGDLSVLSRVPPEQLAELDAAVAQCIVNVARHAQVDEMELAVGVGGGEVTVAVMDSG
                     VGFDTSHVPEDRIGLRTSIRARVEQAGGTVRLWSTEGIGTTVVLTLPLEPHDDRPTAG
                     EANA"
     gene            96744..97967
                     /locus_tag="MTO99_00420"
     CDS             96744..97967
                     /locus_tag="MTO99_00420"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44297.1"
                     /translation="MNTGLRITQQELDPLGAVAARGLVLTGAVAATLLATGLTLVHAG
                     ELRSAPAAALGVLLVAIAGAMAVIGTSPARGPFTSERLGLVVVLAGGGAIAEFVSTAG
                     EDRYLYDDYGAAVVGLLILVLAPFCSWRALALAGVLSAAVLSILVVGGTSIVVPLGPL
                     PATILVRVAVVLAMSAAAAAYSASLAADVLRWQREANRAALARAVAAASGRSRPTAGR
                     TSPVAVLSGEVLPFLAGVMTSDRISVDDADRARDLAEALRRAVREGVEATWLDDLASA
                     LTADEGIAIEVADEASDARSFTEDQRSAVAALLSWLAGGGRTSAVRVVLRRQEGAGTS
                     ASPPSVRRAARRFALDDAASSLGHVVIDATPGPRPPSRRELRRFASIARAFGMGARTA
                     VTGENVMVELRYVIE"
     gene            97983..98597
                     /locus_tag="MTO99_00425"
     CDS             97983..98597
                     /locus_tag="MTO99_00425"
                     /EC_number="2.7.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013585736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004797 - thymidine kinase activity
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine kinase"
                     /protein_id="UOE44298.1"
                     /translation="MAKLYFRYGAMNSGKSTALLQAAFNYEERGHEVLLAKPAVDTKG
                     DREIVSRLGVTREVDFTIGPDDEVLPLFERQRAAVVERTGRDVSCLLVDEAQFLTANQ
                     VDDLLRIALMDDVPVLAYGIRTDFQTVAFGGSRRLLEVAHSLEELKTICRCGRKAIFN
                     GRLIDGRYVFDGDQVAIDGQDVTYESLCGACYLQESGGVLNGRH"
     gene            complement(98745..99488)
                     /locus_tag="MTO99_00430"
     CDS             complement(98745..99488)
                     /locus_tag="MTO99_00430"
                     /inference="COORDINATES: protein motif:HMM:NF014566.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="UOE44299.1"
                     /translation="MNRSDGARLGDDAAETAANARRRLVVGAVALVVAIVAIVAWGWL
                     VRTVVIPEPVQLFAAYLVVWIPLAIAVVVAVRRHGSGSFVHDLGLRFRWIDLLWGFGV
                     GCLVRGVSAVIETAVWGRMSGSGVAFGVDPAWAWFTLLVAPVLIGPLIEEVFFRGLTQ
                     RAVTDRSRAASARPRTAAAIGIVATALVFALLHLLEATSPGTAVVLELSSFTVGLGCG
                     ILAALTGRIGGAIIAHAVSNGLLVLLVVS"
     gene            99573..100994
                     /locus_tag="MTO99_00435"
     CDS             99573..100994
                     /locus_tag="MTO99_00435"
                     /EC_number="2.7.10.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012297645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0045226 - extracellular polysaccharide
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis tyrosine autokinase"
                     /protein_id="UOE44300.1"
                     /translation="MELSDYIRVLRQNWIIIVACALLGIGAAAAYSFVQTPKYSSSAK
                     VFVSTSTGGTIGEMQQGNAFTQQRVTTYADLATTPIVLLPVIDQLRLDVTDDVLAANV
                     GAVALNDTTLIEITVTDESPARAAQVATAVSENLTKVVGAIESTESTTADGQTTASSP
                     VKLTLVQHAAVPQRPVSPNVPLNLVLGGLIGLAIGVGIAVLRATLDTRIRSERDIEQI
                     TETPIIGGIVFDPKAKDRPLIVHADPHSPRAESFRALRTNLQFLELDRPERAFVVTSS
                     IEGEGKSTTAANLAIAIADAGSRVLLVDADLRRPKMAQYLGLEGAAGLTDLLIGRADL
                     QDVIQPWGRGEMYVLPAGRVPPNPSELLGSAAMQKAVAELARAFDVVLFDAPPLLPVT
                     DAAVLSRTVGGAIVVVAAGRAHRGQLKGSIDVLANVDAPVSGIVITMLPTKGSDAYRY
                     GRYGYGYGYRYGPAAEPAEPTVT"
     gene            100996..101598
                     /locus_tag="MTO99_00440"
     CDS             100996..101598
                     /locus_tag="MTO99_00440"
                     /inference="COORDINATES: protein motif:HMM:NF013607.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low molecular weight phosphatase family protein"
                     /protein_id="UOE44301.1"
                     /translation="MRVLFVCTGNICRSPLAERLFAARLERLGVDAVVSSAGTRALVG
                     SAMTPEALDVLVAAGVEPRPHSARSLTPDLVRQSDLVLTATRAHRAEVASLVPAASRR
                     AFTLREFARLAEFVLLNGTGSAASAEHPAAMLQHLLQAVPAQRGLAVPPAAPEDDDIL
                     DPYGRAPDVYAAAGELIERAIDAILSPLAMPIVRGDRVGT"
     gene            101629..103104
                     /locus_tag="MTO99_00445"
     CDS             101629..103104
                     /locus_tag="MTO99_00445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015490289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transferase"
                     /protein_id="UOE44302.1"
                     /translation="MLTRAARPTSSWMSTADWSDALVMRVRVTDLLVLLWVVFGTQIG
                     WLGIDRSATGFSGSRDDIAISYTVLSLVIVVSWMVALELYDTRSPRVLGVGTAEYKAI
                     ADGAVRLFGLVAIVAFLFKVDVARGYVLIAFPLGLLVLLLSRWMWRQWLGMVRRRGGL
                     TTRVLLIGSEQSVRTIGRALVRMPEAGYQVVGVCVPGGSGETLDGTSIPAVRTFANPL
                     AVMRDFGADTIVITSADELGPERVRELSWGLSAGAEHLVVAPSLIDIGGPRIHTRPVA
                     GLPLMHVETPRFEGRKLVAKRAFDLVVGGALAVVLSPMLVGVAIAVKLSSPGPVFFRQ
                     TRVGKGGRPFQMLKFRSMRDGADAELAALLREQGAGDTPLFKVKEDPRITPVGRILRK
                     YSLDEFPQLFNVLGGSMSLVGPRPQVPAEVELYDRGAHRRLLVQPGMTGLWQVSGRSA
                     LTWEEAIRLDLYYVENWSLTGDLMIMIRTARAVLAPGRSAV"
     gene            complement(103132..103608)
                     /locus_tag="MTO99_00450"
     CDS             complement(103132..103608)
                     /locus_tag="MTO99_00450"
                     /inference="COORDINATES: protein motif:HMM:NF013077.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase family protein"
                     /protein_id="UOE44303.1"
                     /translation="MPRSIVERAVEIALESPTACNRQPYEFYLVDEPSLVPKVAAVPM
                     GTAGYVHGLTALAVIVGDLSAFADERDRHLIYIDGSLAAMSFILALEAPGVSTLCINW
                     PDIRSREQAMAQLLRLEQHQRIVMLVAYGFADEQARVPFSQKKPVGMAHTFVSSVS"
     gene            103821..105059
                     /locus_tag="MTO99_00455"
     CDS             103821..105059
                     /locus_tag="MTO99_00455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003404757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004803 - transposase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="IS256 family transposase"
                     /protein_id="UOE46018.1"
                     /translation="MIDPVAGEIIDQQQIAAQLLAQAKEQGVSLVGPGGLVGNLTKTV
                     LETALEAEMTEHLGYEKHGASEGDNARNGTRSKTVLTAVGAVQIDVPRDRDGSFQPKI
                     VRKRQRRLDGIDEIVLSLTARGLTTGEVAAHFDDVYGASVSKDTISKITDKVIEEMTE
                     WQNRPLDRVYPVVFIDAIVVKVRDGQVRNKPFYVAVGVTTAGEREILGIWAGDGGEGA
                     KFWLGVLTELKNRGVEDVCIVVCDGLKGLPESITTTWELAVVQTCIIHLIRNTFKFAS
                     RKYWDQIARDLRPVYTAPTEAAAKARFEEFAEKWASMYPAIRKLWENAWSEFIPFLDY
                     DIEIRRIICSTNAIESLNARYRRAVRARGHFPNDAAALKCLYLVTRSLDPTGRGRARW
                     VTRWKPALNAFAITFEGRIN"
     gene            complement(105127..105639)
                     /locus_tag="MTO99_00460"
     CDS             complement(105127..105639)
                     /locus_tag="MTO99_00460"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44304.1"
                     /translation="MIRRILATIAVAAAALFAAPAAAQASEGGTGYVGQGTNLTLTVG
                     QVGTMTFTGLPPSTPSTATAPDAVTLAVLKAATASRPTDASGTVSYQVSSNTPGTYTV
                     TVTAGQYVATGTLTVVPADTAGKTTGTAATGFDLPVLWIWIAVGAIVLGAALVLVLTT
                     VRRSRKAEAE"
     gene            complement(105708..107618)
                     /locus_tag="MTO99_00465"
     CDS             complement(105708..107618)
                     /locus_tag="MTO99_00465"
                     /inference="COORDINATES: protein motif:HMM:NF024594.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4012 domain-containing protein"
                     /protein_id="UOE44305.1"
                     /translation="MRGSRGSEKGAAGGDRAHRSSGGSHSGSGRSHGSGHHHRSSTAR
                     RRKRTRRILTWSLVGLAALLVLSLAWVGIRALLAKNELEAAVPLARQAQEQILDADAA
                     AAPKTARDLADHAASAASLTGDPIWRLYESIPGLGPNLEVLRSISASVDRAASGAVLP
                     LAAAAEGMDLARFAPVGNRIDLQPIVDLQEPAHQARVAMDTAAAIVEQPRVAAADVIG
                     PLADARDEYVDLIGQARDVVGALDRATTLLPPMLGAAGPRDILLLFQNNAELRSLGGI
                     PGALALVHADGGGIGLVQQASSSDFPRFDPPVVQLPIETRALWGDNTARYIQDATFTP
                     QFPLAATVAREMWRQRFGQEVQTVVAVDPVMLSYLLRATGPLTLSTGDVISADNAVTF
                     LLQDVYLRYEVAQQDAIFAEVAAAAFDALAAGGADPRALIDAFAQAGAERRILIWNAD
                     ANEQAALTGTSLVGALPEGGDDEQAFGVYFNDATGSKMDRFLQLGIDVGTVTCRNDGL
                     PLYEIHVTLTNTAPGDAATSLPAYVTGGGRYGTPPGSIRTTVHAYSELGSYNLGVKLN
                     GEPTGYHPTSDTGYTLSKVVSTLAPGETATYTFGFLGGESGSKQPIIESTPLMTPIEP
                     QRVALSCDSAVW"
     gene            107797..107999
                     /locus_tag="MTO99_00470"
                     /pseudo
     CDS             107797..107999
                     /locus_tag="MTO99_00470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010890217.1"
                     /note="frameshifted; incomplete; partial on complete
                     genome; missing N-terminus and C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS481 family transposase"
     gene            108200..109591
                     /locus_tag="MTO99_00475"
     CDS             108200..109591
                     /locus_tag="MTO99_00475"
                     /inference="COORDINATES: protein motif:HMM:NF016328.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Coenzyme F420 hydrogenase/dehydrogenase, beta
                     subunit C-terminal domain"
                     /protein_id="UOE44306.1"
                     /translation="MSERNQIRHGIEQVVERGMCIGCGACAIRTGGAIAVTLGSRGLY
                     QANLATATSEQISLATRVCPFSDAAKNEDALASERFGDLPHDDRIGHYSAVMAGRLTE
                     DDSVVQSSSGGLATRLLSGLLERRVVDSILHVGRSDGSELFEYVVSSSVDELLSARKS
                     MYYATTLAEVGAALRPDKRYAVVGVPCFIKAMRLLADEVPALNRQLAFFVGIVCGHLK
                     STFFAESLAWQAGVPPSSLETVDFRVKNPTRAANRYDYSATARTGERVVRPVASAIDG
                     SWGYAAFQPEACNFCDDVFAETADVVFGDAWLEQYQRDWRGTNIVVTRDARATEILRA
                     AEDTGAVVLTDLGPDEAARSQAGNFRHRRVGLRVRLADDIAAGLSVPIKRVSPSTDGV
                     SRGRIRLIRQRRDISRMSLEWFEQARATNDLDHYIDRMRTAIARYQRVDAAQRGPIAI
                     LRYLVRKVRGTKR"
     gene            complement(109888..111078)
                     /locus_tag="MTO99_00480"
     CDS             complement(109888..111078)
                     /locus_tag="MTO99_00480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_021754435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004803 - transposase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="IS30 family transposase"
                     /protein_id="UOE44307.1"
                     /translation="MELRERGWSIAAAAREVGVSRTAGHNWSRGYKTYRGGVVVGFVA
                     PLERLAVREISERFLSEDERIQIGDSLRAGKSMRTVARELGRSPSTIAREVARNSTGR
                     DRYRPFEAHRHAVARRGRNHVPRIDSEDRLFAEVDELLQQRWSPEQISLHLRAKYPTD
                     ATMHLSTESIYQAVYRPGSPLSRPTRLAPHKPSPLRTGRQHRRAQQGTDRRRPRFEQP
                     MLTIHDRPFDPADRSELGHWEGDLIIGKEQGSAIGTLVERQTRTSRLLHLPLRDADAL
                     HDALVARMSDLPAELLKSITWDQGTEMARHLRVKESLGVPVYFCDSHSPWQRGSNENM
                     NGLLRDYFPKGTDLSIYSAGHLRAVEDELNARPRKVLQGRSPAAVLPTLIASPHVPGV
                     ATMT"
     gene            complement(111344..112651)
                     /locus_tag="MTO99_00485"
     CDS             complement(111344..112651)
                     /locus_tag="MTO99_00485"
                     /inference="COORDINATES: protein motif:HMM:NF016145.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide pyruvyl transferase family
                     protein"
                     /protein_id="UOE44308.1"
                     /translation="MCKPRDPPSASSDNLQCDRLARYPARSSFEHSQEGAVRFVVSKE
                     PSLSDRYHPRVLVRSLPLESGNYGGLLQAYALQQALLVLGTNPMADRADRFDKYSSKR
                     LKEAARRVIVALGYRNPGWLTRIARDADRRGVATFADRHIRSVPLYVSRQRVDAALVD
                     SFDAFIVGSDQVWRRRYADPRPNLFEFLEPDDGRPRFSYAASFGRDDIDDYGAGLIAQ
                     TAELAQRLTAISVREASGVDLVWKNWALRAQQLIDPTFLVEPERYISLASTAVDPQPQ
                     GRVIDYVLDDNPAARRTVNGIMNHLGDASFSLLPPTPRSYWDFRRHREQFRRPSVEAW
                     LGAIGSARFVITDSFHGTALSIIHHVPFVSILNPFRGAARLESLMDLFGLEDRIVEAG
                     AAIPAAVVDRSIDWDRVDATIERERERATVYLCRALSGDRSWH"
     gene            114865..115578
                     /locus_tag="MTO99_00490"
     CDS             114865..115578
                     /locus_tag="MTO99_00490"
                     /inference="COORDINATES: protein motif:HMM:NF020339.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GT-D fold domain-containing glycosyltransferase"
                     /protein_id="UOE44309.1"
                     /translation="MSATDTLIAVHRERLSLARFGDGELGMMLNPKLSIPFQTNSPDL
                     AQDLRTTLAEPAENLLLCLPSTYNLKRSANPRMAARWWTRHGSRILQLIPESATRFGD
                     QMVSRMWFFEEYGQDAVRLWRDIWDGRQALVVTGEGSRFELLDELFDNLQSADYLFSV
                     AKDAYADLDRVVDEVQKRSPDLVLISLGVAGTVLAHRLARVGVQALDIGHLSASWNYV
                     YKDGQRPEAMPVWTGQANN"
     gene            116610..117740
                     /locus_tag="MTO99_00495"
     CDS             116610..117740
                     /locus_tag="MTO99_00495"
                     /inference="COORDINATES: protein motif:HMM:NF016145.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide pyruvyl transferase family
                     protein"
                     /protein_id="UOE44310.1"
                     /translation="MTLLVNTITRHFTRNYGSFLQTLATQEILRRAGATPRFIDYRQS
                     NVDDTGWSIASRSTVPRFGQVATALYASVRHSNARHMGRVFESSIQENLTLTRDVYRS
                     IGDLRASDEFDAASAYCVGSDQVWNVIHTHDNGPYYLEFAPPGAHKFSISSSLGMQRL
                     PSAEEDRLIHALSTFRGVSVREQQTAEYLAELGIAAQSHVDPTLGVSRSFWNEFAGGG
                     DDVQSPYLLVYQLNRGPVFPLVVEALSKKLGLPVVRVEYWSQHRRGSGRKIVLPAARD
                     FVRLFRDASFVVTDSFHGTAFSTIFDRDFVVVPPPRFDGRIRSFLSLTGRTDLLVTEP
                     GEALEAATAAAPTLVIRRILDHERRRLQDYVGSMVAAAGEHR"
     gene            complement(117796..118794)
                     /locus_tag="MTO99_00500"
     CDS             complement(117796..118794)
                     /locus_tag="MTO99_00500"
                     /inference="COORDINATES: protein motif:HMM:NF025025.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="UOE44311.1"
                     /translation="MTPASHPKVSIILPVYNAESYVKGALLRLLDQTFIDFELIVVDD
                     SSMDRTRDLAQSVARQDVRVRVIELPVNGGVASARNDGLALATGTYVWFVDVDDAWDD
                     GFLARTVDALERRSADLAVCSAVHRFGSDWSSNEFVVRYRNENVLEGIEAVESLLAGS
                     GALWNKLFRRDVLGLNPFPPLRSKSDHAGVLLVLPELRRIVTVPEVLYTYVQRDGSIS
                     NGGNPQPQNFLVLLGIAAASLGQFPNTRRFRHAHARFRCSIIARALREAWRYPTGASE
                     LAKQLPTMVTWREVLLTGASDRRAFVTCAAAKIAPRSAKRAFRHIGRNRWTTQGAV"
     gene            complement(118791..119678)
                     /locus_tag="MTO99_00505"
     CDS             complement(118791..119678)
                     /locus_tag="MTO99_00505"
                     /inference="COORDINATES: protein motif:HMM:NF016800.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen ligase family protein"
                     /protein_id="UOE44312.1"
                     /translation="MVVTLLMIAVAMLQQFANLDVFSGVDFGTRRDTARPSAMTGSFL
                     HYPIALSLLSFILLGLHSTTRRRMHLVVACAGFLATIVSYSRSGMVITLVGLAIGVVL
                     AKSLRSAIRVAIVLPVLAVVLALGLPVDTYLERFLSIFRSDGSGNPGRIAAWQRILDT
                     WSSSPLVIGSHAGEYSNISSNLGALGRVGSPESGLLQVLISLGIAGVVAFYGLMLISV
                     FASPSGAPWFRAGLLGGIVQSFAYQSVEVLPFMAIYAITPLIATATITRIDGRVPNDQ
                     ELGVSVFSVRRRNAERGAT"
     gene            complement(120104..121018)
                     /locus_tag="MTO99_00510"
     CDS             complement(120104..121018)
                     /locus_tag="MTO99_00510"
                     /inference="COORDINATES: protein motif:HMM:NF025025.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="UOE44313.1"
                     /translation="MAIDCGLDVVIVTYASEAHIRQCLDSLFRHRPSCEMRVLLVDND
                     SPDSTLDVVRGDYSEVLVIAREHNDGFAVANNAALRATTAPFVLVLNPDTEIEAGTLD
                     HLMSVMANEQSIGVLGCRLLTADGTLDHASKRSFPSPMTAAKYFLLKAIGRSGSAYVR
                     PDVDENSIADVDAINGAFMLVRARAMDEVGLFDEKYWMYGEDLDWCARFHSAGWRVVY
                     DGTVVAHHLKGGSTGGRRPMRLNYHFHRSMEIFYLDHVSSGHRLADAIVSMGIWLRFA
                     LTSVSHSVANATRNRPMAKKPAVDGAVD"
     gene            121245..122483
                     /locus_tag="MTO99_00515"
     CDS             121245..122483
                     /locus_tag="MTO99_00515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003404757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004803 - transposase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="IS256 family transposase"
                     /protein_id="UOE46019.1"
                     /translation="MIDPVAGEIIDQQQIAAQLLAQAKEQGVSLVGPGGLVGNLTKTV
                     LETALEAEMTEHLGYEKHGASEGDNARNGTRSKTVLTAVGAVQIDVPRDRDGSFQPKI
                     VRKRQRRLDGIDEIVLSLTARGLTTGEVAAHFDDVYGASVSKDTISKITDKVIEEMTE
                     WQNRPLDRVYPVVFIDAIVVKVRDGQVRNKPFYVAVGVTTAGEREILGIWAGDGGEGA
                     KFWLGVLTELKNRGVEDVCIVVCDGLKGLPESITTTWELAVVQTCIIHLIRNTFKFAS
                     RKYWDQIARDLRPVYTAPTEAAAKARFEEFAEKWASMYPAIRKLWENAWSEFIPFLDY
                     DIEIRRIICSTNAIESLNARYRRAVRARGHFPNDAAALKCLYLVTRSLDPTGRGRARW
                     VTRWKPALNAFAITFEGRIN"
     gene            complement(122840..124582)
                     /locus_tag="MTO99_00520"
     CDS             complement(122840..124582)
                     /locus_tag="MTO99_00520"
                     /inference="COORDINATES: protein motif:HMM:NF012235.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein/permease"
                     /protein_id="UOE44314.1"
                     /translation="MSVLPQGAGRFFTAYAIAQGGLALLDGFAVVLLVAVLTPLSGGG
                     VAELPVIGELSGGAIVVTLAVMCLLIVAKSVAAIFLLRWASRRSAHYDAYLAQQLFTA
                     YLRAPWRERLSKHSSEVVSLTGVSVRTTVFQFVLPATQLLGELTTLLAVIIVLAAVQP
                     WAAALALVYMSIVGALLLFWIAKRTRRAGRVVYENQLAEARLITEIIGAFKEIVLRGK
                     TDEVSEVVGRTRRAAATAFAKVQYLSQSPRYVVEAAIIGGFALIGGTALAIGGPDYAL
                     FSIAVFGLAGFRLTPSVIRVQSIANSLQYAEPQARRVVDELLVASDRPRPSQPTGVTL
                     PPHPRAIEIDRVGVRFHHKSHAALEEVSLQIPFGSSVAFVGASGAGKSTLVDVILGLI
                     EPDIGTVAIDGVPINRLVDSWGPSIGYVPQDVILFDATVAQNVALTWTDDPDPDRVRE
                     ALQRAQLLDTIESRPGGLDARIGERGLRLSAGQRQRLGIARALYTSPKVLVLDEATSA
                     LDTTTEAAVSEAIRQLAGEVTVIQVAHRLATVMSADLVCFLRDGRLVAQGTFDEVVDA
                     VPDFALQANLAGLR"
     gene            124812..125219
                     /locus_tag="MTO99_00525"
     CDS             124812..125219
                     /locus_tag="MTO99_00525"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44315.1"
                     /translation="MTPSTVTTPGASVDARQRSPRRRRWIWVTLVILLAVVIALAAWV
                     GIRAFLAKGELEAAVPLVDTTRQHIIDGDTQAAEASARVLAGHASEAAALTGDPVWRV
                     AELLPWAGVNLEGMQVIAASVDRVASGAVTPLA"
     gene            125266..126160
                     /locus_tag="MTO99_00530"
     CDS             join(125266..125616,125618..126160)
                     /locus_tag="MTO99_00530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010080128.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology.
                     GO_function: GO:0004803 - transposase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="IS5 family transposase"
                     /protein_id="UOE44316.1"
                     /translation="MSRFQVLSDAQWSLIEGMLPRPTGRKGRPFSDARTMVEAIIYRY
                     RAGIAWRDLPEVFGPWQTVWTWHHRMATEGTWEKVHAKLTAAADAAGLVDWSLSVEST
                     IARAHQHATNTTRLTGAGSNYTNLREEPPDHAIGRSRGGLSTKIHQLVDGNGLPLVTL
                     ITPGQAGDSPMFLPLMAHLRVGRETGRPRTRPDAVRGDKAYSSRAIRSHLRDRGIKAV
                     IPEPDDQKGHRKRRGSRGGRPVGLDAIDYENRNVIERRFCHLKQWRRLATRYDKHAVT
                     YRAAVLLHSIIAWTQQLSDTP"
     gene            126198..127406
                     /locus_tag="MTO99_00535"
     CDS             126198..127406
                     /locus_tag="MTO99_00535"
                     /inference="COORDINATES: protein motif:HMM:NF024594.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4012 domain-containing protein"
                     /protein_id="UOE44317.1"
                     /translation="MRAASTRHRSWRCKRDALDSGRLADPDIDLIGPIAEARDELVAL
                     LADTGAIVDALDRATRLLPAVLGADGPRNILLLIQNNAELRSTGGVPSALALIHAEGG
                     ALSLAAQADSGDTGRFDPIVTELPVESRALWGNNPARYMQDVAFLPQFPLGAPIAREM
                     WRQRFGVEPDLVVALDPVVLSHVLEATGPVTMSTGDVLEAGTVVQRLLADVYARYPNP
                     ADQDAFFAGAAAAVFEAVAGGSAGAADPRPDRRARTVGRRAAHPDLERGCLGAGDSRR
                     HHARRRFAPKRRRPAGVRGVPQRHDRVEDGHASRRRDRRRLDDVPRRPARRVRDRRHP
                     HEHRARRRGDESARVCDRWRRLRHTGRIDQHLGARVQPAGHLQPRGLAGGCPYVFCQA
                     ATGWVRAGTS"
     gene            complement(127367..128572)
                     /locus_tag="MTO99_00540"
     CDS             complement(127367..128572)
                     /locus_tag="MTO99_00540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011273191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004803 - transposase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
                     /protein_id="UOE46020.1"
                     /translation="MTGHTDVEVFIGLDVGKGEHHAVALDRAGTRLFDKPLPNDETRL
                     RTLIDELRGRGPVLLVVDQPATIGALPVAVAQAAGALVGYLPGLAMRRIADLHPGEAK
                     TDARDALIIAETARTMPHTLRSIQVADEQIAELSMLCGFDDDLAGQIVQASNRIRGLL
                     TQIHPALERVIGPKLDHPATLDLLQHYPTPAAMTAAGEKRLGNRLIKLAPRKGREWAG
                     ELIQALRQQTVVVLGTNAAGTVLPRLAEQLAGLRQQREDVAAEVEQLVAAHPLHPVLT
                     SMPGVGVRTAARLLTEITGKAFPTAGHLAAYAGLAPVTRRSGSSIRGEHPSRRGNKTL
                     KRAMFLSAFAALRDPESRAYHDRKIAQGKRHNQALIALARRRSDVLYAMLRDGTLYEV
                     PARTQPVAA"
     gene            128995..129393
                     /locus_tag="MTO99_00545"
     CDS             128995..129393
                     /locus_tag="MTO99_00545"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44318.1"
                     /translation="MTTNVGTSVTLTFTGFPPNTPSTATAPDAVTLSVIKASMFSRPT
                     DAAGSVSYTASSTTPGTSTITVTAGQVVATGTLTVVPADAGAGTGDRALMGTGFDLPV
                     LWIWIGGGALILGAALIVVLTTVRRARKHA"
     gene            129574..129870
                     /locus_tag="MTO99_00550"
     CDS             129574..129870
                     /locus_tag="MTO99_00550"
                     /inference="COORDINATES: protein motif:HMM:NF012791.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="UOE44319.1"
                     /translation="MGEIAVGVSGAGPATERAVRWAAERAAALGSPLRLVHVVDSAIE
                     ATGDALGSAAEELLDEALPTPELGIERRVVAGAPVIALVDKVAKRKPASDGSMT"
     gene            129993..130793
                     /locus_tag="MTO99_00555"
     CDS             129993..130793
                     /locus_tag="MTO99_00555"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44320.1"
                     /translation="MRTLHNIGNHVFAVANAVRLAERLGAGTVVLPQDSIFNPGSVGA
                     IELTKARVPDGATGIFGSFFYFDSLGFTRTTLERARVLLALRDRLPEQQQSEDFVLHL
                     RAGDVFRPRPHPRYAPPPLDYYLAAIEKTAPARVVAVTQSHDHPYLRVISLHCRSQGI
                     DFLEVNGSAEADFHRLRSARTLCVSQGTFAVSAAWLSKNCDSLLQFDQGPLPPYTTFY
                     PEISQQLGIHVALATATGHPREWHGTAAELVELMSRRNRIDWTSYGPD"
     gene            130945..131925
                     /locus_tag="MTO99_00560"
     CDS             130945..131925
                     /locus_tag="MTO99_00560"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44321.1"
                     /translation="MSDILERFGVTEDLVAGSLRASGLSPRTADRATDVTRASLERAV
                     ELITPVRCGIPLMRIGPKRDGGYLVPDDLDGIEACFSPGVANFKDFEDDLARRFGVKS
                     FMCDYTSDVELLRTPLIDGLQRFEKKWLDVGPSENNLDINDWVRANSSPGADLLLQMD
                     IEGAEYRNLLHATDETLSRFRIIVLEVHSLQLLLESEFLYGIFLPVFERLARHFVCVH
                     AHENNCCTSTKLGPDLIVPNVLELTLLRRDRVRNTPVEVQLPHAMDALNVVSRRRPRH
                     LKGAIRRNADVRASRRNARRLSARWAVLYGPHLVFRRIPRRIVRAMRSRA"
     gene            131992..132843
                     /locus_tag="MTO99_00565"
     CDS             131992..132843
                     /locus_tag="MTO99_00565"
                     /inference="COORDINATES: protein motif:HMM:NF012791.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="UOE44322.1"
                     /translation="MGEIAVGVSGAGPATERAVRWAAERAAALGSPLRLVHVVDSAIE
                     ATGDAELLLAAQSSARESLAVAHDVVDAVAPQLEVIDDLEQGNSVEVFERISRGADLL
                     VVGSDWHGGKRPSRRGVHSLRIAAASAAPVAVIPDVDVTGRRGVVVGVDGSEVSDRAL
                     AFAAVEAERRGEPLIAVHAWDIAVMVGGEYGYGVAMVGADALGSAAEEVLDEALRTTA
                     AAHPDLEIERRVVAGDPVAALVEEAVHASLIVVGSHGRGALARFLLGSVSHGVLAHLE
                     VPTIVVR"
     gene            132885..134051
                     /locus_tag="MTO99_00570"
     CDS             132885..134051
                     /locus_tag="MTO99_00570"
                     /inference="COORDINATES: protein motif:HMM:NF019403.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF418 domain-containing protein"
                     /protein_id="UOE44323.1"
                     /translation="MPRASASNAGPETSGHPLVPLPRRIDGVDIARGLALVGMFVAHV
                     APPAATAEAAALIAIADERPRLLFALCAGFGLGFLTGGTRPVPAGPGGARRRLRVQLA
                     IRGLILIVLGLVITGGLRPLVFVILDVYGVAFLLMLPLLFLRPWVMLAVGSALLAVAP
                     GLAVLASRTQWVADARAAGWALPVDWFVSGAYPVVEWVPIMLIGLGLARLGATRPTVV
                     AWTAGVGASVMLLLLAPATALLDRSSALDGALAGAASAAQADAMHAEALYSAALGESL
                     RAVANVGFAALVVAVAVWLTALTWPRVRQVAGLVLSPFAAMGSMPLTIYTAHLVVIAG
                     SIRVEDGRLTDDSWPLLIGLIAGSMVFALLWRRFVGRGPLEEAIRLASGRARVR"
     gene            134184..135518
                     /locus_tag="MTO99_00575"
     CDS             134184..135518
                     /locus_tag="MTO99_00575"
                     /inference="COORDINATES: protein motif:HMM:NF016145.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide pyruvyl transferase family
                     protein"
                     /protein_id="UOE44324.1"
                     /translation="MSRIIASARRLQRRIRAGFSPRLHAAIARAVLADPPEARAGSGA
                     GSARQVVIAPPGGGNIGDAALVGAYLEHVEGDVVVVTRRADDFDLSSYGERVQVLPMP
                     MLLYGGTLQFARGLRRLRAHVARGTTVAVLGADIMDGAYHAAASANRALIAAGAAEAG
                     LDSRIVGFSWNTAPHPKARWAMRRAAEAGVLLTPRDPVSAGRLGGDVAGSRGASDSVG
                     HSSAGGSPDRGGVVLAADLVFTARSLAPLPDDLARALDGAERIALVNVSGLIAAHVPA
                     GANAAVVHDLLETCDRVVIVPHVSRPGADDLPHCRDLADRFAGDERVVLVDRLLAPPQ
                     VRELAARAHIVITGRMHLAVMSLMAGVPAVTIASQGKVEGLMALFDLPALCVEPGAAL
                     AAELPSRLAKVLADRDEIAARIAERLPAVRSLAERSFTATPVFHQGEHLVST"
     gene            135683..136987
                     /locus_tag="MTO99_00580"
     CDS             135683..136987
                     /locus_tag="MTO99_00580"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44325.1"
                     /translation="MSEISRRSVIVGAAAAAATVVVGVGAAVGIGALADGGADTGAKR
                     SAPPTPEPAEPAPLADAVDAVDASGAPARVPSFGPNGTHWPAHTPVPGGPGVRTVDVD
                     CTWKAIGAAIAAATDADIAQGLHVRVRPGALPGFGAAASAAPVLANLGKATWPKNVLV
                     SPRDGWGTVTIADSMRLDRVLGVTFARFTARFILLTDCSRTCVAQTKVQTGLRITASK
                     TDVTQCDVYEVVMPDSRIDTNDPFGYATGEGASLSASTWEGCYIAPVFRPAGGDQHLD
                     ALQMYGRGFTRGLTVRDSVVFGGLNCALQLGGPHPNDPNLGTPYFTLDHSIAAAQLFA
                     VRTRYPTPDGAHQATLAQAINGTGEPGQLYAYDSLVLGSLYDTSWGEVQRSATSYLKA
                     RSKNPSRSGGWNVDPSLSEWSAADIDALAPRPTDDLLARIWR"
     gene            137006..137566
                     /locus_tag="MTO99_00585"
     CDS             137006..137566
                     /locus_tag="MTO99_00585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005266131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="UOE44326.1"
                     /translation="MNGLDVLLAMQRARDAAYSRIAARGFHRFGRDSRILLPFRVGNA
                     DFISIGDGVLIGAGSWLLVPRRDLAAPAIVIGDRVRMNQTSITAVAEVVVEDGVGIAR
                     GVYISDHSHGFDDPDTFIRDQPIARVAPVRIGRGAWIGHNAVVLPGVTIGAGAVIGAN
                     SVVRDDVPPRTVAVGSPARVVRSLAA"
     gene            137563..138780
                     /locus_tag="MTO99_00590"
     CDS             137563..138780
                     /locus_tag="MTO99_00590"
                     /EC_number="2.4.-.-"
                     /inference="COORDINATES: protein motif:HMM:NF025072.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="UOE44327.1"
                     /translation="MTRADDLVEPQAAGTGAADGSTAPLDVVFTFSYETWNDACRRGM
                     MRPPDRLAGHLIDHPGVRRLVVANPWRWAPTAAGRRVLRLDEPFPSGRGRRLHTPLRL
                     GRRDPEALAAVERSYRAYGRSIARAAADLDTPAVITANPLAAGFGDFSWAGRVTYYGR
                     DDWSSSPARREYWPAYREAYRRIADTGVAVAAVSQQIIDRIAPTGPHLVVPNGVEPGE
                     WLGPAPAAPDWFDRIPAPRAVYVGTLDSRLDVEGIESLARARPDVQLVLVGPQPDPGY
                     LAGVGTLENVHVHAGVGRAELAATLRHAEVALLAHRVTRLTEAMSPLKVYEYLAAGAP
                     VVSIDLPPVRGLGDRVRLVDRVADFVDVIDDALADGPAAEPERQRFITENSWESRHRA
                     VLGLALGNPNMTG"
     gene            139030..140598
                     /locus_tag="MTO99_00595"
     CDS             139030..140598
                     /locus_tag="MTO99_00595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transferase"
                     /protein_id="UOE44328.1"
                     /translation="MSETTLSAAVQPPHTPKRAPHRHPLRTDVAYQPRSLAWPRKLAS
                     AITATDAVTIAVSLVVAQIARFGIEAVGLGARRIDIAYAIAGLGIGVLWMAALSALRS
                     RERRIIGVGVAEYQRVANATLIAFGAVAIFAYLSGIDLARGYLGVALPVGLALLLIGR
                     VLWRQALQALRRGGRCLTGAIVVGSTIDVERVVDALHRNLRAGYRPIAIALTDGDGDS
                     VAHGDPVADRTARHETSARMRALPQIARDDLVEVSKRTRTRAVMIAGDLPGGRGAIRA
                     LGWDLENSKVELILVSRLTDVAGPRIHLRPVEGLPMVHVDLPQYSGFAHSVKRGLDLV
                     LAGLALLLLAPLFAALAVAVRLDSEGPVLFRQQRVGAHGARFTMLKFRSMVVDAEALR
                     DRIAADRDDGNGVLFKLRDDPRVTRVGRVLRAYSLDELPQLWNVLKGDMSLVGPRPPL
                     PDEVERYEHRDGRRLLIKPGITGLWQVSGRSDLSWDESVKLDLYYVENWSVTSDLLIL
                     LRTVRAVLRRDGAY"
     gene            140650..141606
                     /locus_tag="MTO99_00600"
     CDS             140650..141606
                     /locus_tag="MTO99_00600"
                     /inference="COORDINATES: protein motif:HMM:NF016027.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44329.1"
                     /translation="MTDNTLLVCSGGGHLKQLHTLAERMGIPPEDQTWVTFENGLSRS
                     ILADREVIYAPFAAPRDAMNILRIRALARRLLRGRTFERAISTGSSPAVAFLPLTRKR
                     GIPSYYIESAARATGPSVSGRLIRMSGGIPTYTQYPAWATDRWQYRGSIFDEYEPVAE
                     RTPRPVRRAVVSVGTQEGYRFDRLYRTLVPLLADCDEVLWQTGAQDVTPFGIADGRAS
                     VPHAELEQAVAEADVVVAHSGTGAAITALEQQKFPVLVPRRAMHREHVDDHQVQIGAE
                     LDRRELAIMRDADELTAGDLAYAASRTTRRVAAPPFVLEQAA"
     gene            complement(141673..142605)
                     /locus_tag="MTO99_00605"
     CDS             complement(141673..142605)
                     /locus_tag="MTO99_00605"
                     /inference="COORDINATES: protein motif:HMM:NF012863.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDSL-type esterase/lipase family protein"
                     /protein_id="UOE44330.1"
                     /translation="MRRSGSRLRFGGGGRSASGRSTSIRVGCLAAALLATTALAGCTP
                     AEPPVATPTPTPTAASPLEGIATLIAVGDSITLGVNACGELARCPAASWATGADPAVE
                     SLATRIGRATGVAPEASVVAGEGARMGDLVDDVPRIVADDPDLVAVLLGSNDVCAPST
                     DQMTSIDAFASAAEQVVGGLADALPDATVLVLSVPDLEQLWNLGRASDQAVGAWSRSP
                     ACRSLLGEPRSDAPADVARRADVAARVDAFDAALADVCSTRENCVFDDGAVHATAFGV
                     DDVSHVDFFHPSVSGQRAIAEAAWDALTREPTAG"
     gene            complement(142602..144116)
                     /locus_tag="MTO99_00610"
     CDS             complement(142602..144116)
                     /locus_tag="MTO99_00610"
                     /inference="COORDINATES: protein motif:HMM:NF024832.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="UOE44331.1"
                     /translation="MTGTAERDRDPRREQLGHKASRGVAVTMGGLWSKTLIQMLSTVV
                     LARLLDPADFGLVAMVMAIVGVADLVRDFGMTGAILQARALDARLWSSVLWFSVALGL
                     VLTAIVAASAPLIAALFDEQRLVVLTLAIAPTLLVNGLAMPMQAKVQRDLRFGTLANV
                     DVVSMAVGVAGSIAAAFAGWGVWSLVVLAGLGQVYRLVALWVAAKPRFGRPRIERRVL
                     PLVTTGGSIFGVQLLNYAARNLDNVFIGQQLGPAALGQYTRAYALFLLPLQQLTGPLG
                     RVALPVLSALQDDADRYRRYIRGAVLVIGYLSLPTYAVLAAVSDPLITVLLGPDWGHA
                     AQIFSILAIAGVAQAIGNVQGWLYITLGRAHRQFAYYLVTRPIVIGGFLVGLWWAGVN
                     GLALVYGLTTLALLVPGFWFAIRGTFVRGGDILRPVLRPALLTPFVFAASWATVQLLD
                     LPEFVELVLGGVAGLVPLGLAIAVPAYRRDLAQIVAFVKKMRRPATAASTGEDA"
     gene            complement(144113..144982)
                     /locus_tag="MTO99_00615"
     CDS             complement(144113..144982)
                     /locus_tag="MTO99_00615"
                     /EC_number="2.4.-.-"
                     /inference="COORDINATES: protein motif:HMM:NF012745.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="UOE44332.1"
                     /translation="MTARMSVVVPAHDEAAIIGRLLRRIVEGDPDGRIELVVVANGCT
                     DDTARVAASVHPRVQVVELDEGSKIAALNAGDRAAVAFPRAYVDADVLISATTLLDLA
                     DALDRPDGPLVAAPGLHVDTSGASAAVRAYYRVWALSEYRGDGHIGSGVYAVSAAGRA
                     RWAEFPDVIADDRFVQQQFLREERLTLAHASFTVRAPRTFRAQLARATRIRTGNRELP
                     ASLQVAATAPASARYGALVRKVARRPRLWGSFAVYCVGYGVPIVRSRVDALLGRTTGW
                     NRDETVRAEAART"
     gene            complement(144979..146562)
                     /locus_tag="MTO99_00620"
     CDS             complement(144979..146562)
                     /locus_tag="MTO99_00620"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44333.1"
                     /translation="MAGTAVSSGRRVAPGEGARANARASIATAVVTFAALASALVLPP
                     MVAGGALLAVALLYLTRTLVFSWTGALVALAAVIMLVPIRRYALPIPLPFALEPYRLL
                     IVVLIVAVTVALLVDPAFRWRPVRFGWPIGVFIGTMLLSISVNGAGLVEQGLAAAAVG
                     AVVNILLLLSVLFTARQLLREERHVMLLLTFLAWAGAAVGVFAMVEKVTRQNVFLMLG
                     NVLPLTLLREEGESLRAGGARAYASAQHPIALAVLLCMLVPIAIYLAKYAGWPRNEIN
                     RRIVYGVVVGCLLLGVLAAISRTAVVVLAVMFLVTLVFRPYLAITLGLLALPALLLGM
                     AVQPKIVGELVGSFFDLDSLVASQYTSAGWGGAGRLADLEPAMREAATLPFFGTGPGS
                     RIVIGEERNAYILDNQVLGTLLETGAVGVIGLAVFVLAPPIMLLAFAFRSTAALRHRF
                     LAFAIAISCSGYAAALFFYDAFGFMQTFLVLCLLLACGAWVLTEAPSRVPIAAPGTMP
                     RGTPNPEHRPRPSAPEPAA"
     gene            complement(146566..147405)
                     /locus_tag="MTO99_00625"
     CDS             complement(146566..147405)
                     /locus_tag="MTO99_00625"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44334.1"
                     /translation="MDVPKYLQTLWSYRALLGVGIVVAVAAALLAGFTIKDGEVVSRA
                     DRVYTASTTVLLGSESKPLFQAEVPGVPIEQGTTPPEQLDLTSTAVVYAYLVSGTEIS
                     ERVQAVVGEFADGELLTAVRRTTQPAGDESFPGRLTLPILDIVGASGDPERAEQISRT
                     ANDVFQKYVTSEQDAAKIPEENRVQLTTIKQSDAVEEDGSNPAIPIVVTGLGVFLLFV
                     ALAFLLDNVKRSRARRRGRPRAGAGATPDEASEASEALDERELHDVLTGSQPVFAGES
                     RPD"
     gene            147666..148970
                     /locus_tag="MTO99_00630"
     CDS             147666..148970
                     /locus_tag="MTO99_00630"
                     /inference="COORDINATES: protein motif:HMM:NF024968.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="UOE44335.1"
                     /translation="MTDVTRRPRDQDRLRILYSFPHPIGAPGIGWTASNQVAELVAAG
                     HEVHLVAAAVDRPVDGVASLTRTMTVGGRRVPHALLGGDRAYSWHDRRAAARLRAVRP
                     DVVHGWPLASLRTFELARDLGIAAVREAPNTHTAHAYAVVARELAALGIELPQRATHA
                     FNASRLAIEQREWDAATGVLVPSTAVERTFLDRGFPRARLLRHRYGARPDAVPARRDD
                     PGRPFTAVFVGRCEPRKGLHHALRAWLSSTASQHGRLLVYGEFVPAYRDVLRDQLDHP
                     SVECLGFSDAPAHVFAEADVLVLPTLEEGSALVTYEAQLAGCVPLVSSAAGAVIEHGV
                     HGLVHEPGEVAALVGHLDRLSTDPDELARLRAGALAHADDLTWAAANVALVAAYRAAR
                     DLVAAGAPVARREPGAAPEPVADEASGARPSAAEGAAHARAD"
     gene            148954..149886
                     /locus_tag="MTO99_00635"
     CDS             148954..149886
                     /locus_tag="MTO99_00635"
                     /EC_number="2.4.-.-"
                     /inference="COORDINATES: protein motif:HMM:NF025025.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="UOE44336.1"
                     /translation="MPAPTELTVIVCSRERPDMLARSLASIVAATPLGAEILVVDSAS
                     TGSATLDVAADAGVRAVRSDVSGLSIARNLGLASTDRPYVLYTDDDCVALDGWTDRIL
                     RHFDDPRVGAVTGRMLDHTLVTEPSSIAGVDRLERTLDGLDGGHGALMGFRRELILGL
                     GGFDEVLGAGREFAGAEDLDAFCRVLQSGYALVHDEGAVVHHVNTREGEAYTDLHRGY
                     GLGLGAMANKWIRTRPTVGIPMLGILLKRTAVRAVRHTRHARRGAADRAMLRGILAGL
                     ARSTRMRLDGERFVDDHRPTPVSPAAEPGRAGLA"
     gene            149899..151230
                     /locus_tag="MTO99_00640"
     CDS             149899..151230
                     /locus_tag="MTO99_00640"
                     /inference="COORDINATES: protein motif:HMM:NF014998.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="wax ester/triacylglycerol synthase family
                     O-acyltransferase"
                     /protein_id="UOE44337.1"
                     /translation="MPNHAAVELMGTLDEKFIANSVAFEAARPACTMVVDGGPLRAPD
                     GRLDRELIVDLVRSAVARMPAMSRRLRRTPLGLTAPAWVAVEQLDYAFHVRFHPAVVG
                     DGTERAELFSGRGNGPMRLDRPLWDILVAELDSGQVALIGRAQHALGDGIYGMRLIDA
                     LVDGRPFLATHAAAAERAALAQAPQPPRTGTGLLLAAASVWWSAQPGLGGAWREYSRK
                     PFRRRLRRWGGRLARPVRNRIIARRGLIERMLPPRHSALAEFDLGEVRAVARAAGGSV
                     SDLTVALALRAVARVLPDEAALLVPISKRERGNGGEQRNHIVMTRVTAADGGSLGDLV
                     AIVARQVAGARDGGGSGGLEPRAGYASYLPWRPRRAYFGPAEVHAMTLWPVLEPRDEI
                     AVFASSYHRRFTLAVTASAGIDLAPVVAEFERAIRGAEAVAEPAVEEVLDA"
     gene            151227..151787
                     /locus_tag="MTO99_00645"
     CDS             151227..151787
                     /locus_tag="MTO99_00645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019180971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="UOE44338.1"
                     /translation="MSRTLGFLRSILDPRVWVHRLRLAHFDAYSHVRQVPKLTRGPNV
                     TFAPNVSFRNAERITLGAGTHIGEHSVVWAGDSTGRITLGDHCLLAPNVTITASNYGI
                     VQGRNVMHQPKLERDILIGRDVWLGANVVVVAGVTIGDGAIVGAGAVVTRDLPANCIA
                     GGVPAKVIGTRPLDVPADVPTEERVA"
     gene            151784..152746
                     /locus_tag="MTO99_00650"
     CDS             151784..152746
                     /locus_tag="MTO99_00650"
                     /inference="COORDINATES: protein motif:HMM:NF025025.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="UOE44339.1"
                     /translation="MIAQVSVIVVSFNTREATLACLASIAASHDGVPLQIVLVDNGST
                     DGSADAVRAAHPDAVVVDAGGNLGFARGVELGVAHASGDAVLLLNPDTLVLPGSLQRL
                     VDHAEAHPEYGVYGGRTLRPDGTLDPSSCWGAPTLWSLVCFATGLTTAFRGSRVFDPE
                     SLGRWQRDSVRTVPIVTGCLLLARRSDWDRIGGMDEAFFLYGEDAEFSMRARRLGYRP
                     VIVPDAVIVHEVGGSSSSSGAKMCLVMAGKATLLRRVRRGPAAALGIVLLQAGAGLRA
                     LLERVTRAAEPSWSIVWRRRADWRTGYPEAEPRLLGGEAAEVRA"
     gene            152743..153885
                     /locus_tag="MTO99_00655"
     CDS             152743..153885
                     /locus_tag="MTO99_00655"
                     /inference="COORDINATES: protein motif:HMM:NF012744.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="UOE44340.1"
                     /translation="MSARVPGALRVEAEPAFRTAHANPYNANLARSLQREGVDVRDLS
                     YLRLLVRRTDIVHLHWPELTFLSGHRAWRMRARLALFFTFLRIARLRGTRLVWTVHNV
                     EPHERRATPALHARYRRLLLGNVDGILALTEEGVDAARTGHPELRDIPAFVTPHGHYR
                     DDYDFGATRAEAREQLGLRRDATVIASVGMIRPYKNIPRLLSVVRALDDPTLQIAIAG
                     RASSPELARELAEAAERDPRVVLATGFQPDDRLARWLRAADLVVLPYTRIQNSGSAIL
                     ALSADRPVLVPAIGAMRELAALVGDDWVRCYEGELDAATLADAIAWAGRGSGARSERP
                     DRPDLSELDWPRIAGLTLDAYRAVLHGPSVAGRPPGAAHREPVGSR"
     gene            153885..155612
                     /locus_tag="MTO99_00660"
     CDS             153885..155612
                     /locus_tag="MTO99_00660"
                     /inference="COORDINATES: protein motif:HMM:NF012311.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="S8 family serine peptidase"
                     /protein_id="UOE44341.1"
                     /translation="MASQRIPKVPGGLSGRGFPASPGALRARGRRGSGLAAGALLLVG
                     GLAFGTGAAITAAGTPMAAEPLPAGTYTVSFVSDDAADFAVAALGLAPTERYREVLDG
                     VSVRLTGAQAGRLAASPLVEGIAPELVVEGFAQTLPPHVPAVEADEPPVRAGDGTTDW
                     NGPAVAVIDSGVSDHTDIDLRQAVNCFGSGTAGDANGHGTAVAGYLGAYDDADGTVGI
                     APGAPIYSVRVLDDRNRGTTSTLLCGLDWVAQNAARYDIRVVNLSLGAPGADDGDCGR
                     RNGDVLHQAICALTARGIVVVASAGNSDASLAGVVPAAYDEVLAATNVADYDGRPGGL
                     GRAPCAVSTPDDRPALNSSFAVGADTAHTLAAPGMCPYTTLKGNRYGIIQSGTSMSAA
                     AVSGVVLDCLAVGGECRGATDAAVRRTVLQQAEHAAARGHRYQGDPLSPVAGKYYGYL
                     ASTVPSDATPTPTPTPTPTPTPTPTPVPDRTPPSVAITSPVSGSTVAGTVSATATATD
                     ASGVASVAFFSGTTKLGDAVRLADGATWRLSLDTRGFPNGTYGVLARAIDAAGNTATS
                     STITVTIRN"
     gene            155622..156932
                     /locus_tag="MTO99_00665"
     CDS             155622..156932
                     /locus_tag="MTO99_00665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012038115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose/GDP-mannose dehydrogenase family
                     protein"
                     /protein_id="UOE44342.1"
                     /translation="MRVSVIGCGYLGAVHAAAMAELGHEVVGIDIDERKIARLAVGDP
                     PFFEPGLPEILRSALGSGRLRFSSDPADAAGAEVHFLAVGTPQAAGGHAADLRFVDAA
                     FDALLPHLAPGAVVAGKSTVPVGTAERLADRLAEVAPHATLAWNPEFLREGFAVKDTV
                     QPDRLVYGVRSPEASDVLDRVYASAIEAGTPRIVTDFATAELVKVAANAFLATKISFI
                     NAMAEIAETVGADVTQLADAIGHDTRIGRRFLNAGVGFGGGCLPKDIRAFTARAEELG
                     RGESVAFLKEVDAINLRRRHRVVELAREILGGDRRTVFGRKVAVLGVTFKPDSDDVRD
                     SPALDVAVQLKGLGADVVATDPEGIENARARHPQLHYVADPREALRGAELVILVTEWA
                     DYRVLDPNEVGDLVASRAVIDGRNVLDPSAWRAAGWRYHALGRG"
     gene            complement(156853..157377)
                     /locus_tag="MTO99_00670"
     CDS             complement(156853..157377)
                     /locus_tag="MTO99_00670"
                     /inference="COORDINATES: protein motif:HMM:NF016763.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ family protein"
                     /protein_id="UOE44343.1"
                     /translation="MSPTSRVSFGAAVVGRSRPLPPVVVAYAVALGLVGFWPRPVDRA
                     FAGVADLVIAALHAMGGPPWLDPAFAERAANVALFVPLGWLVASAARRRMPAHLAVML
                     AGAVGAVASSLIEFGQAVLLPARVPSEGDVVANLLGALAGAAIVFAISRDRVRDIASP
                     PRAMPTGRARSARR"
     gene            complement(157380..157853)
                     /locus_tag="MTO99_00675"
     CDS             complement(157380..157853)
                     /locus_tag="MTO99_00675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014922592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ family protein"
                     /protein_id="UOE44344.1"
                     /translation="MGERSRSRSSTIARALLVPYLVLLALIVFLPAREAGRVTGIVGW
                     AAELLAGFGVPREPAAVALEFLANVALFVPFGVLLALAWPRLGAWSVIGIGAATATVI
                     ELVQLGIPSRVSTVSDVIANTTGTAIGLVLVLAVAAGAVHRHQRVVRSSRRRTIL"
     gene            157919..159220
                     /locus_tag="MTO99_00680"
     CDS             157919..159220
                     /locus_tag="MTO99_00680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012038115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose/GDP-mannose dehydrogenase family
                     protein"
                     /protein_id="UOE44345.1"
                     /translation="MRISVIGCGYLGAVHAAAMAELGHVVVGVDVDEQKIARLAVGDP
                     PFFEPGLPEILRSALGSGRLRFSSDPADAAGAEVHFLAVGTPQAAGGHAADLRFVDAA
                     FDALLPHLAPGAVVAGKSTVPVGTAERLADRLAEVAPHATLAWNPEFLREGFAVKDTV
                     QPDRLVYGVRSPEASDVLDRVYASAIEAGTPRIVTDFATAELVKVAANAFLATKISFI
                     NAMAEIAETVGADVTQLADAIGHDTRIGRRFLNAGVGFGGGCLPKDIRAFTARAEELG
                     RGESVAFLKEVDAINLRRRHRVVELARELLGGSVHGRKVAVLGVTFKPDSDDVRDSPA
                     LDIAVQLKGLGADVVAVDPEGVENARARHPQLEYSTSTATALDRADLVVLATEWAEYR
                     ALDPAETLRSVAAARIIDGRNVLDPDAWRAAGWTYRGLGRP"
     gene            complement(159301..159377)
                     /locus_tag="MTO99_00685"
     tRNA            complement(159301..159377)
                     /locus_tag="MTO99_00685"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(159341..159343),aa:Pro,seq:cgg)
     gene            complement(159433..160380)
                     /locus_tag="MTO99_00690"
     CDS             complement(159433..160380)
                     /locus_tag="MTO99_00690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018172643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="UOE46021.1"
                     /translation="MAIGAAGLAAFAYGSLIERTRWTLRRVDVPVLPAGSTPIKVLHL
                     SDLHMAPWQRSKQQWVRSLAALEPDLIVDTGDNLGHERGLEGIRAAFEPFRGVPGVFV
                     NGSNDYFGPVLKNPFLYFGGPSAHVPRSKRLDIDALHAYFADLGWLDLDNRAAAIDLN
                     GTRLEFFGVDDPHKGFDRLDLITGAVDDLRADDPLGDESWPDAPREARGPGGRPTLTV
                     GVTHAPYRRVLDSFVNHGAQLILAGHTHGGQVCVPGYGALVTNCDIPRKQVKGLSVWR
                     HGLRSAFLNVSAGLGTSITAPVRFACPPEATLLTLIPAP"
     gene            complement(160416..163091)
                     /locus_tag="MTO99_00695"
     CDS             complement(160416..163091)
                     /locus_tag="MTO99_00695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase domain-containing protein"
                     /protein_id="UOE44346.1"
                     /translation="MSAQNRSTSGVATGVLGLIGMSALAGILVTAAVTPALAVTGIAA
                     NSGISMFENLPGYLEIGDLSEKTDVYATNADGSTHLLASFYEDNREEVGWDQISQYAK
                     DAAVAGEDPRFYEHGGIDVQGTVRAALNEYVIGGATQGGSSITQQYVKNVLVNNAVRK
                     AKTEEEKEAAVEAAIETTPERKLKEMKYAISLEKKTSKDEILRGYLNIALFGGRVYGI
                     QSASQYYYSKNAADLTLPEAASLIAIVNNPEKFRLDNPESESNGANTVDSETGEVVPY
                     AATKERRDYILDEMLKYGKITQEDHDAAIATPIAPAINPPSTGCQTAGSSAYFCDYVK
                     NAILNYYDDPTTTDIDEGQELLNEGGLQVFTSIDLELQAKAQQAIDENVPYVDDRFDV
                     GSVAVTVQPGTGRILAMAQNKHYSQEQAVLDADRSYSAINMAAPYDFGGSSGFQPGST
                     FKVFTLGEWLNEGHSLRESFNGNRRPISKFPGACSGGAYTVAGGFNPKNDDATIANNA
                     VDATKYSVNSSFMAMAEQLQLCGIKNTAQAFGVYRADGLELGKRYAYNDDGTPVLNPD
                     GSRALDPDFEFPPSAVLGTEEVAPVTMAAAFAGIANNGYTCSPIAIDKILTKDGEEIP
                     PPPSTCQQSVTPEVAHAMEYAMAQTFNGGTASASNTGTGVPHIGKTGTTDYAYDTWMI
                     GSSTTAATAVWVGNITGGDNRTNLRNVSFDSGAAATARHRIWPMIMELADNKYGGAEF
                     PEPDASAFKQVLVDVPQVAGLTFDAAKQALEAAGFVVEDGGQQDSNLPAGQVTGTDPA
                     GQAGRGATIRVFTSNGQGTTVPDLTGLTEQAAKAALDQAGLKMKGNGGGNQVVTSQDP
                     PAGTAARKGSTVTVQFGGDDDGGNGGTPPTPGTGG"
     gene            163206..163436
                     /locus_tag="MTO99_00700"
     CDS             163206..163436
                     /locus_tag="MTO99_00700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005051231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4177 domain-containing protein"
                     /protein_id="UOE44347.1"
                     /translation="MPAWEYVTTPLLIHNTAAILNNWGSEGWELVQIVQGPEGGLVAY
                     LKRAVGGDSSQAAAAGQAAAAEAAKQFEGDAR"
     gene            163433..163900
                     /locus_tag="MTO99_00705"
     CDS             163433..163900
                     /locus_tag="MTO99_00705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005051228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA family protein"
                     /protein_id="UOE44348.1"
                     /translation="MTFEAELAELGIELPPVAPPVAAYVPAVVTGSYVYTSGQLPFVD
                     GALPATGKVGEGAELVSADAAKGYARTAVLNALAAVRAEIGSLDRVTRVVKLVGFVAS
                     DPAFTGQPGVINGASELLGEIFGDAGRHARSAVGVAVLPLDSPVELELVVEFA"
     gene            complement(164068..166020)
                     /gene="acs"
                     /locus_tag="MTO99_00710"
     CDS             complement(164068..166020)
                     /gene="acs"
                     /locus_tag="MTO99_00710"
                     /EC_number="6.2.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017829068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003987 - acetate-CoA ligase activity
                     [Evidence IEA];
                     GO_process: GO:0019427 - acetyl-CoA biosynthetic process
                     from acetate [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="acetate--CoA ligase"
                     /protein_id="UOE44349.1"
                     /translation="MNVQIDHTLEEIRRFRPSPEFAAQAVADARLYDAASTDRLGFWA
                     DQARELLTWQKPFTEVLDWSNPPFARWFADGELNVAVNCLDRHVEAGIGDRVAIYWEG
                     EPGDSRAITYAELTEEVKRAANALTELGIGKGDRVAIYLPMIPEAVVSMLAVARIGAI
                     HSVVFGGFSADSLASRIDDAEASLVITADGGYRKGRVFPLKPVVDEALAKTEGGSVRN
                     VLVVKRGENDIAWNDDRDLWWHDTVSTASPEHAAQAFEAENPLFILYTSGTTGKPKGI
                     LHTSGGYLTQTAFTHKNVFDLHPERDVYWCTADIGWVTGHSYVVYGPLANGATQVLYE
                     GTPDTPHPGRWWELVEKYGVTILYTAPTAIRSFMKLGRSVVHDFNLRTLRLLGSVGEP
                     INPEAWIWYRHVIGGGSIPVVDTWWQTETGAIMISALPGVTDLKPGSAQVPIPGISVD
                     ILTDEGQKVEGEGGGLLVITEPWPSMLRGIWGDPERFKETYWAKFGDKYFAGDGARRD
                     EDGDFWLLGRVDDVMNVSGHRLSTAEIESSLVAHEITAEAAVVGAADETTGQAVVAFV
                     ILKERHANDLDPKDASEELRRHVAMQIGAIARPRQVFIVNELPKTRSGKIMRRLLRDL
                     AEGRQVGDTTTLADTAIMDIISAQVR"
     gene            166736..167644
                     /locus_tag="MTO99_00715"
     CDS             166736..167644
                     /locus_tag="MTO99_00715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018187051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TadA family conjugal transfer-associated ATPase"
                     /protein_id="UOE46022.1"
                     /translation="MLGPLAPYAADGPVTDLFVNGEAGLWVDRGAGAERHPAWRADEP
                     QVRALAVQLVARGGRHIDEATPAVDVRLGRGIRVHAVLPPISTIGTVISVRVPRAAGF
                     SLAALARAGMLDGAQEARLRTAVADRANLLVTGAAGSGKTTLLAALLGEASASERIVV
                     IEDVAELRVGHPHVVGLEARQPNLEGSGRVGLDALLREALRMRPDRLVVGECRGVELR
                     ELLSALNTGHDGGAGTLHANSLDDVPARLEALGSVAGLTPDAVARQAVSAFDLVLHVE
                     RAAGGRRLAGIGRFALEGDRLAVAPC"
     gene            167638..168678
                     /locus_tag="MTO99_00720"
     CDS             167638..168678
                     /locus_tag="MTO99_00720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010205657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system F family protein"
                     /protein_id="UOE44350.1"
                     /translation="MLNGRGAPGGGAQQPGAGPLARLRRARPDEAAGFEAVAVVAERL
                     AVMLAAGVPAASVWRHLDDAATGVAPAAGVAAAAGAAATAGVAEAAGAAAAAGHPVGE
                     AIARAAPDGPTRAAWSTLAAAWHVAESSGAPLAASLRDLAGALRDEAQARRDVRAALA
                     GPRASARLVTALPLIAIGFGALLGFDTIGVLLGSPIGLVCLAVGGALLWAGARWNAAL
                     ARRAAPERPSPGLELDLLAVAMSGGGSLERSRESVASAIERYVPAAVGIEDVDGTVRL
                     ASSAGAPVADLLRSEAARRRRQARSDAVVRAAALSVRLMLPLGACVLPAFVLLGVAPL
                     MISVVTGTLGAA"
     gene            168740..168985
                     /locus_tag="MTO99_00725"
     CDS             168740..168985
                     /locus_tag="MTO99_00725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017888704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4244 domain-containing protein"
                     /protein_id="UOE44351.1"
                     /translation="MHSTHSIDRRARLARLARARVRRAVRASSRRLLGDRGAATAEYA
                     VATMAAVGFAGLLVVILRGDEVRGILTDLVRNALTVG"
     gene            168966..169310
                     /locus_tag="MTO99_00730"
     CDS             168966..169310
                     /locus_tag="MTO99_00730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010205663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44352.1"
                     /translation="MRSRSADRERGSATAELAVALPAVALVLAACLGAIQLGAQQVRL
                     TDAAADAARALARGESLDAAAGIADRVSGGAALEVARDGPFVCAVLRAGGSGLLSAIE
                     LRSESCAIDGGR"
     gene            169286..169726
                     /locus_tag="MTO99_00735"
     CDS             169286..169726
                     /locus_tag="MTO99_00735"
                     /inference="COORDINATES: protein motif:HMM:TIGR03816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flp pilus-assembly TadE/G-like family protein"
                     /protein_id="UOE44353.1"
                     /translation="MRDRRRALTVCAGTAPSLRLRLRSRLRLRWRRGCRDERGAGTVL
                     VLATVAGMIALTALIVPLLAVPIASQRAANAADAAALAAADALSGAIAGVPCDLAAAV
                     AERNGAQLVGCETAGPVASVSVRRGVLGLAVEARARAGPPGWAD"
     gene            complement(169742..169978)
                     /locus_tag="MTO99_00740"
     CDS             complement(169742..169978)
                     /locus_tag="MTO99_00740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44354.1"
                     /translation="MDTSSTASYTAKLIDGPLEGRTVATAFLDTGDPRPRIELNADGG
                     KRYVYSRGAGLEFDGDNSSLPTAVEYRFVETVFD"
     gene            170335..173154
                     /gene="topA"
                     /locus_tag="MTO99_00745"
     CDS             170335..173154
                     /gene="topA"
                     /locus_tag="MTO99_00745"
                     /EC_number="5.6.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0003917 - DNA topoisomerase type I (single
                     strand cut, ATP-independent) activity [Evidence IEA];
                     GO_process: GO:0006260 - DNA replication [Evidence IEA];
                     GO_process: GO:0006265 - DNA topological change [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="type I DNA topoisomerase"
                     /protein_id="UOE44355.1"
                     /translation="MSGAKKLVIVESPTKMKSIAQYLGDGYTVLSSVGHIRDLIEPKN
                     LPAEVKKRGGGLAKFSVDVDNGFEPYYVVSDSKKKTVAELKRALKDADELLLATDEDR
                     EGEAIAWHLLQELKPKVPVRRMVFHEITKDAILAAKDHTRELDTSLVDAQETRRILDR
                     LYGYEVSPVLWRKVGPGLSAGRVQSAATRLVVDRERERLAFVAASYWDLVGTFTSTDA
                     SFQAKLVRLDGDRVATGRDFDDRGRLKSRAAVLDEATATALAAALRDDTVAKRVSKLE
                     QKPYRRSPAAPFTTSTLQQEAARKLRLSAKDTMRVAQSLYENGYITYMRTDSNSLSKQ
                     AIAAARTQASKLYGPDTVPDKPRSYASRSKNAQEAHEAIRPSGEVFRTPAEVEGQLRG
                     SEFRLYDLIWKRTIASQMADATGHTATVTLEVGPTAADAPAPAEPTAKVGGALAEFTA
                     SGTVITFRGFLAAYEEGHDEERNAEDAPGDARLPALAEGQAVGLAELEAKGHETTPPP
                     RFTEASLVKRLEELGIGRPSTFASIISTILDRGYVTLRGQALVPSFVAFSVVRLLEEH
                     FGDLVEYDFTAEMEDDLDRIASGEADRVDWLNQFYFGGDKHRGLRQVVDNLGDIDARE
                     INSVQVAPDITLRIGKYGPYLEAVDPEAATDAAPRRVNLPEGLAPDELTAEKARELVD
                     APVVGDRVLGLNPANGKQVVVKDGRFGPYVTEVEPEASAPEAGSAEASVDPATGEVIA
                     LRQAQEPPAKAKKAAKKAPAEKPRTASLFKSMQVETVDFETALKLLDLPRVVGVDAES
                     GAEITAQNGRYGPYLKKGTDTRTLPSEDAIFEIDLAGAQELFAQPKYGARRASSALKE
                     FDADPVSGKPIKVKDGRFGPYVTDGETNATIPRAESVEDITFERAVELLQLKRDKGPA
                     KPRAKRTTTAKKAPAKKAPAKKSTT"
     gene            173151..173771
                     /gene="tmk"
                     /locus_tag="MTO99_00750"
     CDS             173151..173771
                     /gene="tmk"
                     /locus_tag="MTO99_00750"
                     /EC_number="2.7.4.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018189948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004798 - thymidylate kinase activity
                     [Evidence IEA];
                     GO_process: GO:0015949 - nucleobase-containing small
                     molecule interconversion [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="dTMP kinase"
                     /protein_id="UOE44356.1"
                     /translation="MSRGLFITLEGGDGSGKTTQAGLLEAWLQGLGRTVVRTREPGGT
                     DVGLEVRELVLHHRGEIAPRAEALLYAADRAHHIATLVRPALARGEVVVQDRYIDSSV
                     AYQGAGRVLDPDEVRRVSEWATEGLAPDLTVLLDLDEDAARARLDAAPRRFDRLEAEA
                     SDFHARVRDAYLALAAAEPDRFLVVDATRPVDEIAAAVRERVEALL"
     gene            173824..175038
                     /locus_tag="MTO99_00755"
     CDS             173824..175038
                     /locus_tag="MTO99_00755"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012297667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0009360 - DNA polymerase III complex
                     [Evidence IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0003887 - DNA-directed DNA polymerase
                     activity [Evidence IEA];
                     GO_function: GO:0008408 - 3'-5' exonuclease activity
                     [Evidence IEA];
                     GO_process: GO:0006260 - DNA replication [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="UOE44357.1"
                     /translation="MSVWSELTGQSAAISVLREAAVASAAPGGAALDDDGADASPAGS
                     AQRMTHSWLITGPPGSGRSNLAYAFATALISGQPDGDEPTRIQVEARSHPDLHVLATE
                     GVIIKRDDVREIVKRSHYAPSVGAHRVIIVEDADRMTEQTSNFLLKELEEPPERTVWI
                     LCAPSEADLIPTIRSRVRTVRLQVPGVADVAELLVRRDGVDPVIAERAAREAQSHIGM
                     AHRLATSPEARARRDETLRLALAVRSTPSAVTTAARLIEIAGDDAKAITELRDAEERE
                     HALRSLGLAPGQTVPPALRAQLKALEDDQKRRATRSLRDGIDRILVDLASLYRDVLVV
                     QLGAGVELVNLELRDEIDAAAASASPARTLATLDAIQVARERIEGNVQPTLALEAMLV
                     AAIRRTADRGAA"
     gene            175038..176576
                     /locus_tag="MTO99_00760"
     CDS             175038..176576
                     /locus_tag="MTO99_00760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017201447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="UOE44358.1"
                     /translation="MRDRRRPVRIAAACATLIAAALMLTGCVNPFAPEAPHTSTPTNE
                     QVDPSLERFYHQTLTWEQCGDRMGCTTAIAPLDWDDPEAGEVELALVRHVATGDRIGS
                     LLVNPGGPGGSGYDFIKDSLDYAVGQPLQERFDIVGFDPRGVGRSSAVACLDPAAMDE
                     YLYGITSAERGSDEWIAEVRASQTEFGAACEQQTGALLAEVDTVSAARDLDLLRAVLG
                     DEELNYLGYSYGTFLGATYADLYPDRAGRLVLDGAIDPSLSENEVTIGQAIGFEQALG
                     AYLDSCLASADCPFDGSVDSAMGEVGRLIASLDRSPLQGSDGRLVGADTFITAIIYPL
                     YSPDSWFALDSLFESVMFGEADYALQLADGYNGRNPDGTYLDNSTEAFTSINCLDYEY
                     QDDVAVMRERAAEVAAAAPVIGPYFGFGDLSCIDWPVPSEAVRRPIHAEGAAPILVIG
                     TTGDPATPYEWAVSLADQLESGVLVSYDGEGHTAYNKSNSCVNEAVERFFIDGVVPAE
                     DPQC"
     gene            176644..176719
                     /locus_tag="MTO99_00765"
     tRNA            176644..176719
                     /locus_tag="MTO99_00765"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:176677..176679,aa:Thr,seq:cgt)
     gene            176822..177808
                     /locus_tag="MTO99_00770"
     CDS             176822..177808
                     /locus_tag="MTO99_00770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="UOE44359.1"
                     /translation="MTDGLRWGILATGGIAHMFTSDLKLNGFDVRAVGSRRVESAQAF
                     AAEFGIPNVHGGYEALVADPEVDVVYVSTPHPLHAANAELAVRAGKHVLIEKPFALNA
                     VEAQRIADLAAEHGVLALEAMWTRYLPHMARIREIIAAGTLGELRTLIADHTQKLSDD
                     PAHRINALELGGGALLDLGIYPISFSWDLFGEPVTIQSTATFKSTGADAQIATVFGYD
                     GGRIATTLSASDAKGPNTATVLGTLARIDIDGVWYTPTSFRVVDADGTVLEEYVSEVR
                     GRGMHFQAAAAEQLVAAGELGGGSILSTAESVAIMGTLDTVREQIGLRYPGE"
     gene            177864..179483
                     /locus_tag="MTO99_00775"
     CDS             177864..179483
                     /locus_tag="MTO99_00775"
                     /inference="COORDINATES: protein motif:HMM:NF014200.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="UOE44360.1"
                     /translation="MRDETDAPDESFDDPERPADGEATEAIPAAPAATPEASEPVPPE
                     ASEPVPPEASAAPDSEASAPAGALTRITAFARRHRTPLAIATGVLAFALLGAGAVALG
                     AAIARPDVEPVAAAETAGPTPTATPRPTSAIAVAPAQIRIRTCSVADRAGDPRLANLQ
                     AQVVNAATGEVLFDRGGSTPSRTASVMKVLTTAAALSVLGPDYRTPTTVVKGAEPGSV
                     VLVGGGDATLSRTPSGTETVYPGAAHLDDLAAQVRAAWNADPSNPPLTKLILDASYFG
                     GAAWHDSWDPVEREDGYMAPVTALMVDGDRDDPSSNTSWRSEDPVARAGDAFASALGG
                     IQAIERGTAPGGTQQLGQVLSPTVAQLVDKALIVSDNNAAEMLARLVAIQTGAGNTFE
                     AINAGVLQGLSGYGVDTAGISIVDGSGLSDFNAVPPSYLTRLFVKINAREGNLGVLMD
                     GLPIAGGPRGSLSYSDRFTGDNAVADGAVFAKTGWIETGYTLSGIIHAQDGTTLTFAI
                     YALGDVSDDAKQAIDTLATGFFLCGDGLAND"
     gene            179612..180208
                     /locus_tag="MTO99_00780"
     CDS             179612..180208
                     /locus_tag="MTO99_00780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase family protein"
                     /protein_id="UOE44361.1"
                     /translation="MTRAILVVDVQNDFTEGGALGVQGGAAVAERISAYLAGHADDYD
                     LVVASRDWHDADNDNGGHFAAEPDFVDTWPPHCVAGTPGAEYHPSFDTSTVDVHVRKG
                     MGEPAYSVYEGHADDGRRITEVLAEHGITEVDVVGLATDYCVRQTALDAVEHGQHVRV
                     FTDLVEGVHHERSAEVLAELAHAGAVIAQSPGTAPEVG"
     gene            180266..180787
                     /locus_tag="MTO99_00785"
     CDS             180266..180787
                     /locus_tag="MTO99_00785"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44362.1"
                     /translation="MPSRRAATTLVFAGLALGSLLFTGCAGPADAESTSAGASSAEKP
                     SSKDATAEKESADDATDAATTEEDCLAFQSALTDSATALQEGMSEYSTDPAAAVATLK
                     DFQGTFDAAVADLSDADVKAVGADASAKLADVIGALEGGVADPANLDMTAYLEKVTAM
                     TESFGAIGEVCAA"
     gene            complement(180852..181994)
                     /gene="hpaD"
                     /locus_tag="MTO99_00790"
     CDS             complement(180852..181994)
                     /gene="hpaD"
                     /locus_tag="MTO99_00790"
                     /EC_number="1.13.11.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016463444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008687 - 3,4-dihydroxyphenylacetate
                     2,3-dioxygenase activity [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
                     /protein_id="UOE44363.1"
                     /translation="MPHRDHLTPTSSGFFVSQEAPIHTDHPIPTPTAPAPDILRCAYM
                     ELVVTDLQRSRDFYVDILGLTVTEEDEQTVYLRSLEEFIHHNLVLREGPVAAVAAFSY
                     RVRTPEDLDKAVAFYTELGCRVERRADGFTKGIGDSVRVTDPLGFPYEFFHDVEHVER
                     LAWRYDLYTPGALVRLDHFNQVTPDVPRAVKFMQDLGFRVTEDIQDEEGTVYAAWMRR
                     KPTVHDTAMTGGDGPRMHHVAFSTHEKHNILAICDKLGALRRSDCIERGPGRHGVSNA
                     FYLYLRDPDGHRVEIYTQDYYTGDPDNPVVTWDVHDNQRRDFWGNPVVPSWYTDASLV
                     LDLDGNPQPLVAREEESELEATIGADGFSYTRRGDEEHGFKLGNTL"
     gene            complement(182061..183557)
                     /gene="hpaE"
                     /locus_tag="MTO99_00795"
     CDS             complement(182061..183557)
                     /gene="hpaE"
                     /locus_tag="MTO99_00795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013838823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0018480 -
                     5-carboxymethyl-2-hydroxymuconic-semialdehyde
                     dehydrogenase activity [Evidence IEA];
                     GO_process: GO:1901023 - 4-hydroxyphenylacetate catabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
                     dehydrogenase"
                     /protein_id="UOE44364.1"
                     /translation="MTDVFTPEGLPDRIRHYIDGESVDSLDGDTFEVLNPVTNETYVH
                     AAAGKRADIDRAVAAARRAFTEGPWPRMLPRERSRVLHRIADLVESRDQRLAELESFD
                     SGLPITQALGQARRAAENFRFFADLIVAQADDAFKVPGRQMNYVNRKPIGVAGLITPW
                     NTPFMLESWKLGPALATGNTVVLKPAEFTPLSASLWAGIFEEAGLPAGVFNLVNGLGE
                     EAGDALVKHPDVPLISFTGESRTGQIIFGNAAPYLKGLSMELGGKSPAVVFADADLDV
                     AIDACIFGVFSLNGERCTAGSRILVQREVYDEFVERYAAQAKRVKVGHPHDPATEVGA
                     LVHPEHYEKVMSYVELGKREGRLVAGGGRPEGFATGNYVAPTVFADVAPDARIFQEEI
                     FGPVVAITPFDTEEEALALANDTKYGLAAYIWTNDLRRAHNFAQSVEAGMVWLNSNNV
                     RDLRTPFGGVKASGLGHEGGYRSIDFYTDQQSVHITLGAPHNPTFGKR"
     gene            complement(183692..184327)
                     /locus_tag="MTO99_00800"
                     /pseudo
     CDS             complement(183692..184327)
                     /locus_tag="MTO99_00800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017793518.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
     gene            complement(184324..186057)
                     /locus_tag="MTO99_00805"
     CDS             complement(184324..186057)
                     /locus_tag="MTO99_00805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="UOE44365.1"
                     /translation="MTSAIATPGKIIAVHLSYASRAAQRGRTPAHPSYFLKPSSSLAA
                     TGGTVERPAGTELLAFEGEIALVIGEPARRVAPEDGWTHVAQVTAANDFGVYDLRTAD
                     KGSNLRNKGGDGFTPIGPVAIPADVAGEGGWRVRTWVNGELVQEDTSDAMIFGFGRII
                     ADLSQHLTLETGDVILTGTPAGSSVVLPGDVVEVEVDAPNAPGAPSTGRLVTSVVQGE
                     VPFGDFGDTPSVDDAQRLEAWGSAEALAAAVAAGRAAPLAKPVALAEPVEATPTDTPL
                     AEPVEATPTGGLPSTGSGSTRFELTDDLRAQLSSVAVATLSVALRKRGYHDVFIEGVH
                     ANLPGARIVGRARTLRFIPARPDLFQSHGGGYNAQKRAFDSVGPGEVLVVDARGERGT
                     GTVGDVLALRAKVRGAAGIVTDGGVRDFDAVAEIGIPVFSQGPHPSVLGRRHVPWETD
                     VTIACGGAAVQPGDVIVGDGDGVIVIPPHLVAEVAAEAAEQDAADAWVAERVAEGEAV
                     DGLFPMNAEWRARYERDRLAESSNTLAEPGNTLAEPGNTLAEPGNTLAEPVEATPTRD
                     PSLRPAQGATP"
     gene            complement(186086..186952)
                     /locus_tag="MTO99_00810"
     CDS             complement(186086..186952)
                     /locus_tag="MTO99_00810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HpcH/HpaI aldolase/citrate lyase family protein"
                     /protein_id="UOE44366.1"
                     /translation="MPIRMNLPDTFAARLAAADRPQIGLWVCSASPLVAEVVAGSGVD
                     WVLIDAEHSPNDLQTILHQLYAVSGYPVAPVVRPPIGDTVVVKQYLDLGVQNLLVPMV
                     DSAEHARELVRAVRYPGAGSAPGAAGVRGVGASLARSSRWNRVEGYLADASSTVSLTV
                     QIESAAAVANVEEILAVDGVDAIFVGPADLAGSMGLLGQPSHPDVVEAALTAIRAARA
                     AGKPAGINAFVPDEAERYLAAGASFAAVGADVALLARATESLADRFVGSRPSAPDATG
                     EPDASSSSRTSY"
     gene            complement(186937..187722)
                     /gene="hpaH"
                     /locus_tag="MTO99_00815"
     CDS             complement(186937..187722)
                     /gene="hpaH"
                     /locus_tag="MTO99_00815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018775072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0018817 - 2-oxo-hept-3-ene-1,7-dioate
                     hydratase activity [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase"
                     /protein_id="UOE44367.1"
                     /translation="MLDDATRDAIADELVAADRDRTTVPLLTARHPDMTIDDAYAVQR
                     RWADRRAAAGARLVGRKIGLTSKVMQVATGITEPDYGVIFDDMVIESGSTVEFDRFSN
                     VRIEVELAFVLADRLEGPHTTIFDVLDATAYVVPALEILNSHIELQGRTIVDTISDNA
                     AMGAMVLGGRPVKVDEVDLRWVSALLSRNQTIEESGVAAAVLGHPAMGVAWLANKLAQ
                     HGQALGAGEIILAGSFTRPMWVERGDTVHADYRDLGAVTCRFE"
     gene            complement(187935..189596)
                     /locus_tag="MTO99_00820"
     CDS             complement(187935..189596)
                     /locus_tag="MTO99_00820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018171801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0030976 - thiamine pyrophosphate binding
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate-binding protein"
                     /protein_id="UOE44368.1"
                     /translation="MPAVSTHVARTLAAHVGHVFGLMGNGNAWFLDALDHDTDVVFTA
                     VRHEAGGVVAADAYFRASGRLAAATATYGAGFTNTLTALAEAVQAEVPLVLVVGDQPT
                     AGRRAWDVDQIALASAVGARTYTVGRTDAAATVVLAIEHALARRQPVVLALPYDVAAL
                     DAGEVPPAPALRHPVPLTPASPYATGVIAELAHALARSRRPFLLAGRGAWLAGASEPL
                     GELAAATGAITAGTALGRGVFPDTRYDLGVTGGFGTEGAMALVREADVAVVFGASMNQ
                     FTMRFGELFAPRTRVFQVDVSPAATHPHVGGFVRGDAAVVARALVAELAKLDATPSGW
                     RESIDLEPLRVYPRPDRADGLADDGRLDPRAVAQRVAELLPEDRVVVSDGGHFIGWAN
                     MYWPIASPDRMVMVGTAYQSIGLGFPSVAGAAAAKPSSTIVLTTGDGGGLMALADLET
                     AVRTAGGRGLAVVWNDAAYGAEVHLYGRKGLAQAPMRIPEVDFAALAAAVGAEGVVVR
                     ELADLDRLGTWAGEASDRRRFLLLDCRISPTVMAPYQHEIIRVNA"
     gene            189948..191483
                     /locus_tag="MTO99_00825"
     CDS             189948..191483
                     /locus_tag="MTO99_00825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="UOE44369.1"
                     /translation="MKKALAAISLTAAAALALTACSSGSEPPAAEGGDIAAKPLSIGN
                     FLDVTSWDPSLADIGFDGPYLSAVYDPLLAIDADGEPQPALATDWETSDDFLTITMDL
                     RTDTTFSDGAAFDADAAVKSLDYLKAGVRSQEAYRNVESFEAVDEDTIAIHLTQRDDT
                     ILYYMGLGRSYMMSPNAIDAGTLAEAPVGSGPYTLGASSVPGAEYHFDKVADHWAADE
                     FPFDPLTITPLSDATAMLNGMQSGQFQLIYGDKAGTDMAPDMGWNVASGLATWVGLQF
                     SDRAGATEMGKPLGELKVRQALNYAFNGPELVETIGQGVGEATNQLFPVGTPGYVDSI
                     TDMYAYDLDTAKSLLAEAGYADGFEITMPMAPQFQAWQAIVEQTFGELGIRVTWKETD
                     FMSYMSVAPDYPMFLAVIAMDSNPIATVQRQIAEPQWYNPTPGIEAFPEVQAQLDVVL
                     TAERGDAQIAEVEKLNQLVTEQAFFSIWSQSTNTYITTADFEVTPITGMMFPTLRQIA
                     VVG"
     gene            191551..192492
                     /locus_tag="MTO99_00830"
     CDS             191551..192492
                     /locus_tag="MTO99_00830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017793523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE44370.1"
                     /translation="MLTFTLKRLASGVILLFVVSTATFFLAYTAIPDPTLGLLGSAAT
                     PDAQAALAERIGTDRPVLVQYFEWLGGLVQGDLGTSWKNFQPVSAQIAVKLPVTLSVV
                     TLSILLSAVLGGVLGVLAGLRPNTWIDRVVKAGAVILFALPGFWVALVLVMTFAVQLQ
                     WFPAVGYVQPTVSLPDWLRSITLPAISLALGAVVMIAEQLRNAIIQADGQDYMRTLRS
                     RGLSQPRLVTHLLRNSAPPSLTILALMFVGLLSGAIIVEQIFALPGIGPLTQSSSQNG
                     DIPMLLGITVITVIFVVIINFLLDVLLGWINPKVRVK"
     gene            192489..194408
                     /locus_tag="MTO99_00835"
     CDS             192489..194408
                     /locus_tag="MTO99_00835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017793524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide/oligopeptide/nickel ABC transporter
                     permease/ATP-binding protein"
                     /protein_id="UOE44371.1"
                     /translation="MTAPLTDRIDSRERERGRGSTFVRLLKRPAGAISLAVLLLIVLV
                     AVFAPLLAPYDPNFVDLTITRAPPSAEHPLGGDTTGRDVLSRLIFGTRITLWGAFVAV
                     ATSIVIGVPSGLAAGYFGGKTDRIGTWISDAVQSVPGMIILLIVGSNTGNNFDILMVT
                     VGVFMAPGYFRLTRSTVLAVRNEAYVDAARVSGLSNARIMGRHVIRPVVAPIVIQSAL
                     TAGMAMGMQAGLQFLGIGGGTTPGWGAAMNEGFRVMRTDPLLLLWPSLALGISIAALA
                     VLGSTLADVISVKTPMLTKRQRRRIAQKNAAALPADAVETVTGSVSHAAADSAVRLEN
                     LRVKYETTNGAVEVVHGITLDVAPGEVLGIVGESGSGKSQTVFSMLDLLPSSGYCTAD
                     AIWIGGEDVTRLPRSARAKLLGHRIGYVPQEPMTNLDPSFTIGHQLTEPLRAVHGLSR
                     ADAKARALAMLERVGIADPARVMRSYPHELSGGMAQRVLIAGAIAGKPSVLVADEPTT
                     ALDVTVQAEVLELLRELQQEYRMALVIVTHNFGVVADICDRVVVMRSGSIEEIGEVSR
                     LFSAPESEYTRELIAASLDGAESRRELDRAGLRPAVGDAIDGGAIDGGAAGPASASAA
                     QTDASTEAQTEEVRA"
     gene            194405..195241
                     /locus_tag="MTO99_00840"
     CDS             194405..195241
                     /locus_tag="MTO99_00840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017793525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="UOE44372.1"
                     /translation="MSTNDAPLLEVSDLVVAYGTKRKPVPVLHGVSLEVGAGECVGLV
                     GESGSGKSTLGKAILGLVPVASGTIGFDGRDITHAKGRDRRALAADIQVVFQDPYGSL
                     DPLMTVGDILAEPLATAGASKAEAKAVVGEMLDRVRLPKHVIDRYPSEFSGGQRQRIA
                     IARALVRRPRLIICDEPVSALDLTTQATILDLLIELQRDTGVSYLFVSHDLGVVRRVC
                     HRVAVMYRGELVETGDGDVITSDPQHAYSKRLLMASPVADPQLQAERRRAWLALREDR
                     AA"
     gene            complement(195496..196710)
                     /locus_tag="MTO99_00845"
     CDS             complement(195496..196710)
                     /locus_tag="MTO99_00845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug effflux MFS transporter"
                     /protein_id="UOE44373.1"
                     /translation="MTTAKPVMSVRRSILVLGLLEAFGPLSMDLYMPQLPQLAASLGT
                     SDALAQATMSVCMIGLGVGQLIAGPLSDRFGRRRPLLIGVALFALFSLACVFAPTIEV
                     LIAARLAQGLAGSAGIVICLAVARDLYQGAELSRMLSLLALVSASAPIVAPVIGGQLA
                     LIMDWRGIFGVLTGIGALLFVLAATSLRETLPPERRHSGGMLRTTGRHLRELARDRVF
                     VTLLVAAAAGGVAFFTYLSQSSFVLQNEYGLSPQLFSLVFAANALANMIGSQVSRVAV
                     RRLGPVRMYLSGQTATAAAASLFVVAALAGLPVAAVVGALAFFLFSIGVGGPNGTTLA
                     LGAHAERAGTASAALGTLQFTVGPIVAPLAALGGSNAIAMSLTMAAGACLAAALAWLV
                     VRPLVARAGLAP"
     gene            complement(196787..197791)
                     /locus_tag="MTO99_00850"
     CDS             complement(196787..197791)
                     /locus_tag="MTO99_00850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020015148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="UOE44374.1"
                     /translation="MSVAAPRPVPYDPELEPGLAFFLDLVERIPLRAETILANREHFA
                     TIIQPIDEQVGDLPVEWEHRLIPGPAGAPDVEITIVRPARVPGASEHADAPLAPGVLG
                     IHGGGYVLGTRFFGTGELIDLALRYGTVGVAVEYRLAPEHPAPAQVEDCYAALEWFAA
                     NAAELGVDPERIIVSGASAGGGLAAAVALVARDRSGPRLAGQLLNCPMIDDRNDTVSS
                     YQYDGIGAWDRNNNDTGWNAMLGPDRGTDRVSPHAAPARATDLGGLPPAYIEVGSAEV
                     FRDESVDYALRIWAAGGQAELHVWSGAYHGFSGFSPDAIVSRAAVAARDSWLRRVLSA
                     "
     gene            complement(197788..198816)
                     /locus_tag="MTO99_00855"
     CDS             complement(197788..198816)
                     /locus_tag="MTO99_00855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019135071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="UOE44375.1"
                     /translation="MTDTATRPAPVPFDPEIAPILDAMAAQPQPAMTEDTLPLMRGTG
                     DAFPGADGERVARERGIEAEERSIPGPAGAPELELTVFRPAGHRPANGGAAVPAVVNI
                     HGGGMVVGHRSWEHGRVADLVAELGIVGVNVEYRLAPEHPYPAGVEDNYAAVAWVAAN
                     AAELGVDPARLVVMGGSAGGGFSAAVALMARDRGGPALAGQLLLCPMLDNTNSTVASR
                     QYDGIGTWQREANLFAWRCVLGEELAYSTEAPAYAAPTRATDLSGLPPAFIEVGAAEM
                     FRDEDVDYATRIWATGGQAELHVWQGGFHGFDMYAPDAEITRAALATRTSWLRRVLGL
                     PATAGGAA"
     gene            complement(198818..199783)
                     /locus_tag="MTO99_00860"
     CDS             complement(198818..199783)
                     /locus_tag="MTO99_00860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017793532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="UOE44376.1"
                     /translation="MTSTATVPRRAIGTSELRASRLSLGSWHTYDRMHFEDAVELVRT
                     AVDRGINLFDVGVYAFPGGPPAFTDVLFSAIIRAAGVAREDYLLSEKLWLEGFGPGGF
                     RPQLERALFRVGTDYSDLVILGDVRENVIDFRDLVLDLAALRDAGLIRAWGVNNWSAT
                     NVQALIDVAAAEGVPGPAIAQLKYSVARRSIPDGAPFAALWQQGVTMQASDVMEGGIL
                     AGNVSPAREVGRDPGGIREQIIASVPDFTAVAADLDTTPAQLAVAFSLTHPAATTTLF
                     GATKLAQLESNLGALDLVERVGAARIRELVDPFQADRDLVDPEGP"
     gene            complement(199795..200904)
                     /locus_tag="MTO99_00865"
     CDS             complement(199795..200904)
                     /locus_tag="MTO99_00865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc-binding dehydrogenase"
                     /protein_id="UOE46023.1"
                     /translation="MTIPLSTRAAVLTAHGAPLDLQELPLPEAIEPGAALVRITCSTL
                     CGTDIEIWEGRMSFPGMLPMVLGHEMVGEVVAAGEGTRDAVGREIQVGDRIGWSESTC
                     GECFGCTVLRQPVACSRRGYGFLQRSDVPPFATAGLAEYAYVVPGAAKLLLPDEVKDT
                     WASMAGCAAKTVLRAFERAGGVQPGSRVVVQGSGALGIFATAVAHLSGAGQVITVGAP
                     AARLAVAERFGADAVVDIAGGSEATVARVLELTDGRGADLVLDFAGAPSVGPEAIGMA
                     AQRGTVVIVGSTGPAGEPITLSAIMGKELTVVGSLNGDIADYYRAIEFFRAFAGRFAW
                     DDLFSEPCGLAEASERIAAMSKLGEIKAVIDPRLN"
     gene            201491..202573
                     /locus_tag="MTO99_00870"
     CDS             201491..202573
                     /locus_tag="MTO99_00870"
                     /inference="COORDINATES: protein motif:HMM:NF019581.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase family protein"
                     /protein_id="UOE44377.1"
                     /translation="MTSRAERRAAILRAGELLASLGITSYTEPGIGPGEDDGQTGCFG
                     QDVFDAYVELEAEGALRARVNVLALFGLLDGASSLEAFAAGLRGLDRETSRPDRLRVA
                     GVKVFGDGIPPMLQAWTRHPYPDGSHGGLLVDGADLADRERNLRAMIRLAHDAGLQVG
                     VHATGDRTIDTVIDEVARAVGDRPADLRHYVIHGDLAAPASIERLARLGMGINVQAGI
                     AGATSGWLAGVLGEEVARAAWPIDAALRAGVLSLSSDAPILGPDWRQGIAAADAWMGA
                     PADDAERAARMGALLRACTVAPARQDRAEAWKGTLAPGMVADLAVLETDPFEVTPAEL
                     PAVAVELTVVDGDIVYERVPAGAAAE"
     gene            complement(202640..203380)
                     /locus_tag="MTO99_00875"
     CDS             complement(202640..203380)
                     /locus_tag="MTO99_00875"
                     /EC_number="1.1.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose 1-dehydrogenase"
                     /protein_id="UOE44378.1"
                     /translation="MTESRTVLVTGGAGGIGRGIAAAFLDAGDRVVLADIDADAVATA
                     AAELGTGSVAVDITDASSVARAIAQVEQEHGPIDVLVNNAGILSVHGSVTELAADDYR
                     SIVDVNIIGTFTMTQAVAKRFIAHGNPGAIVNISSIGGRQPTPGMGAYESSKAAVDSI
                     TRWAAIELAGHGVRVNAVAPGPVLTPMLAMGMPEGSPARAAWTSRIPLGKLAEVGDIA
                     PAVVFLAGPSAAHITGVSLAVDGGQLLV"
     gene            203479..204471
                     /locus_tag="MTO99_00880"
     CDS             203479..204471
                     /locus_tag="MTO99_00880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="UOE44379.1"
                     /translation="MSFTGTVPTRRLGPGGPEVPVFALGSWNIWDRMEPDARVALIRR
                     AAEVGAAFFDVASYNMGPHAEASRTDLYFGDAVREAGLGRDEYLVCGKLWLWEYPQTG
                     FAEQMQTSLERIGIEQADTVVVGDYFGEIDIRRVVRDVQAEIDAGRFDSWGVNNWAAA
                     DLELALDYAEAEGLTPPTFAQLKYGLVRRTMAEGEYYGRWFAEGRLALQASDAFEGGI
                     LVGKTSPARKIGADVGGIREQIVAAYPRVAEIAASFDATPAQLGIAFCLANPATANVL
                     FGASSVEQLDDDLGALELLDRVGADALREATAELWLDRAVNADGTWAPVPAPAE"
     gene            complement(204501..205250)
                     /locus_tag="MTO99_00885"
     CDS             complement(204501..205250)
                     /locus_tag="MTO99_00885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="UOE44380.1"
                     /translation="MPLSTTVTPAVHRPAATAGGTDAPPVVLLHGFASSAETDFGATG
                     LAAAIAAAGRTAIAVDLPGHGRNEPIADASAATTSSVVAAIAAAVADAAPEASVVDVL
                     GYSLGARLAWELPDATGGRVRRLVLGGISPFEPFAAIDPAELDAVLGGAEASNPLTGM
                     MAGMIQAPGLDTASLAKLIVGLASQPFDPAAGAPRVPALFLAGTEDPMSQGVEALVSA
                     VDGARLERVPGDHHGALASPEFRAAALAFLS"
     gene            205377..206360
                     /locus_tag="MTO99_00890"
     CDS             205377..206360
                     /locus_tag="MTO99_00890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylserotonin O-methyltransferase"
                     /protein_id="UOE44381.1"
                     /translation="MTESTATPERILDIAIGFMGAKQLFAASRIGLFAALADGGKSVD
                     ELAEATGRAPRQVRILADSMAAQGLLERADGRYTLAADAAAYLAGTGEVDLTPFLAFL
                     NDISYKQWLDYDATVDTDEPGTLELDEAGWGRFMAGVMTYNVLHGEQLSENFDFSPYR
                     SALDLGGLSPAFAIGAMRQNPDLTTRFVFAPDFTDSVRQAVDAAGVGDRSTVEGGDTA
                     TVQPGGEHDLVMVNHVLHRFSAEENRGILANARGAAADGAKLLLLDFYLDDAEAQRKI
                     DALHAGEYYNIDGTVVYPESEVNEWLEAAGWRAEGAVELPGSPRVLVATAV"
     gene            complement(206554..207147)
                     /locus_tag="MTO99_00895"
     CDS             complement(206554..207147)
                     /locus_tag="MTO99_00895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="UOE44382.1"
                     /translation="MPKVIDHDQRRRDIIDVTWGLIVKGGIEAATMREIAAEAGFANG
                     ALKHYFPGKDEIIEGAYERSLNRLGEILNEAMVGKRGIEGLRTMMTVTMPIDEEDVTA
                     GKVLLSFWERAAFNDSLHTTYRKHLKVWRDGIAHYLREGRELGEIVTGIPDEQLIDEI
                     VLVNAGATIMRVIAPEVTTADLLRRHVDTFIERISRP"
     gene            complement(207238..208920)
                     /locus_tag="MTO99_00900"
     CDS             complement(207238..208920)
                     /locus_tag="MTO99_00900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="UOE44383.1"
                     /translation="MMTDTDEARPTPVADLVLTGGRIATAEPGAPWAQALAIGGGRLL
                     AVGTDASALAFAADATVVRELDGAFVMPGLVDVHNHHALAGRTELFELSIPIGAGLDE
                     IIEGVREHATGLPADAWITGGPWGSTLRAQLSTTDALARLDAASGGRPVVLVEDSRHN
                     RWANSRAMELAGITADADPGEGGVIELDAASGRPTGVLLESAGLPVEHAMARTGSLTA
                     EQHRAASRRGVELLNSYGVTCFQDAAVSLEILEALRSLDEAGELDAWVVSSLTVNDQI
                     FGYDPIGEGLVWQGDRFRTAHHRPDFVKIFLDGVPPARTGAFLEPYLPDEAHGAEFHG
                     ETVLAPDELEGWLRRTAERGLSAKIHCTGDASVRLVLDTVEQLRAEGFTATRYQIAHG
                     QFVAESDLPRFAELGVVADMSPFVWFPGEIPLAIAEVLPPERASHLQPNRSLLDLGAR
                     IAGGSDWPVSPSPNPWEGIHGLVTRTDPSGRFPGTLWPEQAITLDEAITAFTSGAAEA
                     MGLGHETGSLAPGKSADFVVLDRDPYAHPAGELARTGVLETWFAGRRVFARA"
     gene            209190..210728
                     /locus_tag="MTO99_00905"
     CDS             209190..210728
                     /locus_tag="MTO99_00905"
                     /inference="COORDINATES: protein motif:HMM:NF012706.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="UOE44384.1"
                     /translation="MTNRIRSRSGVKAAAVAALACSLALVGCAPPSDGDGVAGAMSLT
                     VGMVGSSGDTLNPYQQQGSNSSGAVFDQVFERLVTRDADGALTLVLAESIEPNETGDE
                     WTITLRDDVKLHTGEQFAAEDVVESLRWMIDPANAWAFASQLDFISSPDQIREVDDLT
                     VVLDLDEPFGLVPEMLAFERAYMRSIRGGATVEEPAGTGPFTVDSFTAGQEARFSRFD
                     DYWGEAPKISSLKFAFFTEQNAVTNAIRGGQIDVARGIPFPEVPALESDPNLELVVSD
                     TAAYPIVAMNLQQPPFDQLEVRQAVRYAVDRDLIVSNAFGGFASVANDFIGMNTACPA
                     PDVPQREQDLELAKQLLAEAGAQGAEVELVTDGAFPGMMEMAALIIEDLNEIGLKASV
                     QQLEVGAFLDRWTEWPFFISFTSSPYEVTAKAHFMPGGSENATWFDDEEYNRLAGELY
                     RTTDPDAQCEIITQLQTIEYERGPYLVPVFGNDITVHRSNVSGLEPDLYGRTAFRLTN
                     VTVE"
     gene            complement(210830..211285)
                     /locus_tag="MTO99_00910"
     CDS             complement(210830..211285)
                     /locus_tag="MTO99_00910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017884670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44385.1"
                     /translation="MSRYDRLFVTRMPNCMAEMVREDSDEVLEYPLPNLGEGLWLMNS
                     DLVPEARINMTHIWIHPSDEPQLWVNPHRHDYDEVLIWTGGDPDDPTDLGAEIFFDIE
                     GERHTITTSGSVYIPAGTLHCPLGFTRVDRPFRFSALSLAPSYRAGDGD"
     gene            complement(211363..212199)
                     /locus_tag="MTO99_00915"
     CDS             complement(211363..212199)
                     /locus_tag="MTO99_00915"
                     /inference="COORDINATES: protein motif:HMM:NF014376.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="UOE44386.1"
                     /translation="MHDLTLDPGSATPVLVQTIDDEAAFRTPHRHAFAQLLVIEAGSG
                     VHDIDFAPVPVRVGELHLLAPGQVHSWHTDPGLRCTAVMFAPDALDPIGGVPERVREL
                     VLFGAAPIVPAPAAAARQRRLLDAIADAGSPAVTTHLLAALLLECGDAADARAGSVAH
                     SPLTRSFIRDVMRHADARLTVTRCAARLGVTAGHLAEQVMADTGSTPSRIIRAAVTRE
                     ARRLLSGTDLSAAQISRCLGFSEASYFSRFFRRETGCTPTEYRELGARGDHGTPAERH
                     AG"
     gene            212435..213448
                     /locus_tag="MTO99_00920"
     CDS             212435..213448
                     /locus_tag="MTO99_00920"
                     /inference="COORDINATES: protein motif:HMM:NF012738.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE44387.1"
                     /translation="MTESIALTSERSTHPARRARRRRTLRMWAGKVLQGVLTLLLVSV
                     LIFFATQLMPGDVAKVILGVNATPERIATVRQQLGLDQPIWQQYLSWLGGILHGDWGV
                     SLTNGVPVADTLSIRLRNSVALGAMALVIMLPISLVVGVVAAQRKDRVFDSIFMGSSM
                     TVNAVPEFVLGTVLIALFGTTVFHLFPPVALIPPADMPWWHPMEMVLPVTTLVIGGVA
                     YLSRLVRVSFIDVMNSEYIQTARLKGLSTRRILYRHALPNALAPIIPAASLVAAFLIG
                     GTVVVEYLFSYPGIGLTLVEAVNNRDLPLIQAVVLIIASAYFVFNFIADLLSDAGSAS
                     RKG"
     gene            213457..214335
                     /locus_tag="MTO99_00925"
     CDS             213457..214335
                     /locus_tag="MTO99_00925"
                     /inference="COORDINATES: protein motif:HMM:NF012738.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE44388.1"
                     /translation="MSQPNDTTTTPAVEPRARSRVLARFLASNQVRWGIGLVILTTLL
                     AYFGGFFAPYPPTEPITTPYAPPGDGLLLGSDQIGRDVLSRVLHGGVHLAWMAPLSAV
                     LSVVIGAIVGMAAAYYRGATETILMRLMDVLLAFPGLLMALLFVSMLGPSPALLVTLV
                     VLALIPGVARVIRGAALPICDREFVQWGRSVGIPGRTMIVREILPNVTSPLLVEFGVR
                     LMWAVGILASISFIGYGIQPPTPDWGLMVSENRTGLATQPLAVLAPIVMIVLFTVGGN
                     LIAEGGARVIARTEGK"
     gene            214338..215918
                     /locus_tag="MTO99_00930"
     CDS             214338..215918
                     /locus_tag="MTO99_00930"
                     /inference="COORDINATES: protein motif:HMM:NF007739.0"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="UOE44389.1"
                     /translation="MPAVSVSGLTVALEATGAPIIDDVSLSLEAGEVLGIVGESGSGK
                     STLSLAMLGYARPGGRITGGSVEIEGTDILQLDADGLRRARRGLVSYVAQDPATALNP
                     SMRLSTQLLEALDGPRDQAIARVREVLSAVGLPNDDAFIKRRARELSGGQQQRIAIAM
                     AVVAQPRLIVLDEPTTGLDVSTQMRVLELVKRLCAEYRIAAIYVTHDLAVVAEVADAT
                     MVMKDGHVVETGPAHEVLLRPQHPYSKALIAATPSTKIRTPWEGDAPAAEPSPSPAAA
                     PLLRVESLTASYGHLEVLHDVDLTVSPGECVAIVGESGSGKSTLSRCLIGLHDDWHGT
                     VALDGRPLAKSAADRGTAERRAMQYIFQNPYGSLNPRQDVGAILSTPLALFEGVTGAE
                     ARRRVVDALERVEMPARMAARYPSELSGGQRQRVAIARALLASPELLICDEVTSALDV
                     LVQSAVIDLLRGLLRDGLGMIFVTHNLAVVRNIADRVVVVNRGTVVEHGGVDEVLDRP
                     QDAYTRGLLANTLDLPAA"
     gene            complement(215923..217125)
                     /locus_tag="MTO99_00935"
     CDS             complement(215923..217125)
                     /locus_tag="MTO99_00935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P1 family peptidase"
                     /protein_id="UOE44390.1"
                     /translation="MSAAELADGFAGTRSGRKARDLGLRMGDLPNGPRNAITDVDGVR
                     VGHTTLISGDGPLVRGEGPVRTGVTVVIPREAPWHHPLYAAPHRLNGNGEMTGLEWIR
                     ESGQLTSYIGLTNTHSVGVVRDALVAHEGTTRPPGEEYWSLPVVAETWDGALNDLNGF
                     HVRAEHVFQAIEQAHGGHVAEGSVGGGTGMIAHGFKGGIGTASRVVAPADGGYTVGVL
                     VQANHGRRDRLMIEGRPVGRAIRLPGDDGSGHEAPDARFSSSLPEGSGSIIVIVATDA
                     PLLPHQCARLAQRSTLGIGRLGGAGENGSGDLTLCFSTGSGEIPAGFGGPGSPLTYTP
                     VALGNDRIDPLFYAAIEATEEAIVNAMLAADTMVGIDGATRYGLPHDQLLRVVGLGPD
                     ERGERGER"
     gene            complement(217122..217523)
                     /locus_tag="MTO99_00940"
     CDS             complement(217122..217523)
                     /locus_tag="MTO99_00940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="UOE44391.1"
                     /translation="MRTNREIIAAHYDAAAHGDLAGMTADFAPEIRWIEAEGFPTAGR
                     YTGADEIGASVFAAIATDWDGFGMHADELLESGDTVVALGRYRGIHRRTGRALDARAV
                     HVWRLADGAITGFEQIADTRLVADAAEAVGA"
     gene            217716..218690
                     /locus_tag="MTO99_00945"
     CDS             217716..218690
                     /locus_tag="MTO99_00945"
                     /inference="COORDINATES: protein motif:HMM:NF012792.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="UOE44392.1"
                     /translation="MTITTTTGARIRPALAAMNDRSRALDPQLPDRAFDDDDPILAAL
                     DGDAVRAVGRVSVAHLAQDQPAAIWGALHRAELELGWSGDAGAMGELLDAWLAEAAER
                     MRRAGADATTDWETSCSLRVPARDSAAVKPLLARGFAVVGVEGIRVGSRGADGEAAQR
                     RLSAAGVRLRPARLDDLALLTELDTELFAHDAQHGSITRRPQAGASLRAGIEARLHRD
                     PEWTWIVECGDDQVGYVSLETDRAEHLGRVAPGADIAFLQAMYLRPEVRGSRIGEAVV
                     EFAHARLEERGYDRVLLDYAALNPRSGPFWCRMGYRPLWNLWQRRPAG"
     gene            218825..219277
                     /locus_tag="MTO99_00950"
     CDS             218825..219277
                     /locus_tag="MTO99_00950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017884670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="UOE44393.1"
                     /translation="MASEYDRLFVRDMPVIANGEMSNEGEAAGMVEPENLGEPFWLMH
                     PDSVPESRINMTHVWVKETDEPAEWVKPHVHDYDEILIWTGSNPDDPHDLGAEIYMEI
                     DGERQIITTSGSVYIPAGTVHCPLGWNRVDRPFRFSALSLAPNYSSRR"
     gene            complement(219402..219770)
                     /locus_tag="MTO99_00955"
     CDS             complement(219402..219770)
                     /locus_tag="MTO99_00955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017793527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="UOE44394.1"
                     /translation="MTAVATVEDEVRAAVERYVQGVSTNDPALVMRAFSDDAVMWGYL
                     GPEFVTQSAAAFAEQVVATAPAPDPAYASEIHSISVTGEVATAVLDERSYLGADFRNH
                     FGLARIEGAWRIVSKVFTTR"
     gene            complement(219767..220258)
                     /locus_tag="MTO99_00960"
     CDS             complement(219767..220258)
                     /locus_tag="MTO99_00960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017884670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44395.1"
                     /translation="MSNTHAGLFVTHMPNIGEDFTNEGDAAGLPTPTNTGEPLGLMRA
                     NEVPQSRIHMSHTWIFETDSPQHWVNEHEHDYDEILIWTGTDPENPRDLGAELYFDIE
                     GVRHSVTASGSVYIPAGTRHCPLGFVQVTRPFNFSALSLSPVYDSDENADLIPQAHAE
                     SAS"
     gene            complement(220408..221358)
                     /locus_tag="MTO99_00965"
     CDS             complement(220408..221358)
                     /locus_tag="MTO99_00965"
                     /inference="COORDINATES: protein motif:HMM:NF025878.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="UOE44396.1"
                     /translation="MTMTPPVPTGSHQAPLLDFSAFSAVASSAFVPLAIRSDERRSFR
                     GQVRTAEIDRLGFTELSATAHRVERTPKLISEGGDCYMVGFMLAGSGILVQDGRELVM
                     REGDITIYDTARPFSLSFDDDSKNFVVMLPKDMIGLPPELVGELTATRLHDEGRTSAL
                     ASQFLLHVPQALHSAFPEVRYGLARTSVGLLEVLLTMALGEERLEQDPHQVLLRKIRD
                     YIEQHLGSPDLTPGEIAHAHHISTRHLHGLFRSQGTTVSGYVRTRRLEHCRQDLVNAV
                     YDDRPVSAIAARWGFIDAAHFSRVFRAQYGATPREVRAQR"
     gene            complement(221529..222476)
                     /locus_tag="MTO99_00970"
     CDS             complement(221529..222476)
                     /locus_tag="MTO99_00970"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44397.1"
                     /translation="MSASPYDPLFVRTMRSCAADFVYEGEPAGLPNPANVDDPLGLMR
                     PADVPQSRIHLSHTWIHPVEHPQHWVDEHRHDYDEVLIWTGADPEHPDDLGAELFFEI
                     EGVRHSVTTSGSVYLPAGTRHCPLGFTNVRRPFNFSALSLSAGYSSGDHDAVRSAASV
                     APPYERLFTRELRVCADDMVNEGEAAGTALPPNLSQPWAIVRADDVPEAKTYITMSWV
                     HPTDEPQHWVDEHEHEYDEVLVWTGSDPDRPHDLGAEVVFEIEGVRHTVTTSGSVYIP
                     AGTKHCPLGFTRVDRPFRFLAIALSGDGHYLPEHERGQR"
     gene            complement(222623..224776)
                     /locus_tag="MTO99_00975"
     CDS             complement(222623..224776)
                     /locus_tag="MTO99_00975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primary-amine oxidase"
                     /protein_id="UOE44398.1"
                     /translation="MHRPDPTHTHGARVTTPGTATHPLDPLTADEIAAARRILDEAGQ
                     VTESTRVPRMLPVDPSKESLAAWRPGDALDRRIRVTLLDRATGVASEAIVAVGRGEVD
                     ELRVLPNGEAPYGQPQYLFEEYDDAAAIVKASPEWQAAMTRRGLAEHLDLAFCSPLAP
                     GFFGRDDEVGRRIVRSHTYLRFHEGDSPWAHPVEGLVVHVDLTERRVIRIDDEGDVPV
                     PEAHGNYTLDVQGPARTSLKPIEITQPDGPSFSVDGSLVQWENWRFRVGFTQQEGLVL
                     NQITWRDGDEHRSVAHRASVPEMVVPYGDTSVSRYWISYFDAGEYLLGKNANSLSLGC
                     DCLGVIHYFDAFVPDDRGNPVKLPQAICMHEEDSGILWKHTDLEGRSEVRRSRRLVVS
                     YFATIGNYDYGFFWYFYLDGSIQVEAKATGIVFAGAGTPGTENPHAPEIAPGIFTPVH
                     QHLFCARIDAAIDGEDNTLHEIEIQGIPTGPDNPYGNAFTWTDTKLATEQQAQRIANG
                     LTSRVWEVRSAHRTNHVGKPTAYRLLPEGKALLAAQPGSSVHGRAAFATKHLWGTRYA
                     PDELYPAGFFPNAHAPGAGLPEWTRADRSIDGEDLVLWHVFGPTHIPRTEDWPIMPVD
                     YSGFWFKPHGFLDRNPAMDLPDGAADHCAPGEGAGPAGEGAGPAGEGAGPAGGHVAGH
                     AGGGAGCCASGGCGCCAGESCRCGDPSCGCGKPKG"
     gene            complement(224783..226192)
                     /locus_tag="MTO99_00980"
     CDS             complement(224783..226192)
                     /locus_tag="MTO99_00980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011693336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase family protein"
                     /protein_id="UOE44399.1"
                     /translation="MHTYESLLAAVTTTSGETREVLDPATGERIGSVRVDGTAELDRA
                     VERARAAQPEWAALTDDERVAVLGRVADAIEASSDALAELLSREQGKPLNGPNARFEV
                     GACVSWLRATAATPLPVEVVVDDGENYAELHYRPIGTVGVITPWNWPMMIAIWQIAPS
                     LRMGNTVVAKPSEYTTLSGLALAAVMNEALPEGVLEVVAGDGSLGAELVKNPAFGKIM
                     FTGSTATGKKIMASSADNLARLTLELGGNDAGIVLPDVDPAAIAEGLFWGAFINTGQT
                     CAAMKRLYVHDDVYDAVCEALAEVASKMPMGRGLDEQNVLGPLQNRMQWEVVNRLVEA
                     AKSSGARVLLGGQPDSEASGHFYPTTLVADIDDANPLVQEEQFGPALPIIRYSDVEEA
                     IRMANAVDVGLGASVWSADRAKAREIAARLEAGTVWINSHGGVHPMIPFGGVKQSGFG
                     LEFGAEGLKSVAVPQIING"
     gene            complement(226330..227295)
                     /locus_tag="MTO99_00985"
     CDS             complement(226330..227295)
                     /locus_tag="MTO99_00985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017828411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="UOE44400.1"
                     /translation="MHPTPTSPSTSPSAPASLEPLDFPAFRTAVSESFVPLKVTSDRP
                     DPFSGSIRHAEADAVHFSIVSATEHAVERTPQLIAADPRRYYKLGLQLAGTGLLVQGG
                     RETLLQPGSIAIYETDRPYSLAFDGDSRTLVVMFPSRLVDLPQQAVAELTATPLGTAG
                     GMGGLVGAFLANLADRFDLVSGISGERIGRNAVDLVVTMLSNELAAGRVEVNPRQRLF
                     AEITRFIDDRLRTGGLDPVSIAAAHYISPRHLHALFHENGTTVSTWVRRRRLEECRVR
                     LADPAFAGRSISSIAADWGFADGAHFSRVFRAEFGRSPSDVRARH"
     gene            complement(227387..227977)
                     /locus_tag="MTO99_00990"
     CDS             complement(227387..227977)
                     /locus_tag="MTO99_00990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017884341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003677 - DNA binding [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="UOE44401.1"
                     /translation="MSSTTPAGRRSLLEATITVVARSGLRALTYRAVAAEAGVSHGLV
                     RHHFGSRDQLIAEALEYAVAESLRETSMTDASGRAATVAADGFASGIESLAERSTDMQ
                     AFQYELLLESRRRPELRPHVERYYETYRRATADQLAALGIDDDAFIETVWFALDGLVF
                     RDLVLGSGPGSARVLRRIRELVAERAARSSRSSTTD"
     gene            228109..229611
                     /locus_tag="MTO99_00995"
     CDS             228109..229611
                     /locus_tag="MTO99_00995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="APC family permease"
                     /protein_id="UOE44402.1"
                     /translation="MSATTVSETPGTDTRQRRRLGVPAVTVLIIAASAPLTVIAGGAT
                     TAYSVTGSIAVPIGYIVLAVVLAIFSIGYAAMSRFITNAGAFAAYAAQGLGRPVGVGV
                     SLIALVAYSCMQIGIWGMFGFQVSTLLAEKFGIDLPWWVGVIVFVVVVGILGVNRVDL
                     SAKVLGVIVALEFIAVTVFDVVAFANPVEGFTADPISPASLLLPGIGAVLVFGIAAFM
                     GFESAAIYGEEAKDPKRTVARATFAAVVIIGVFYALSSWALALAIGTDKISSGGITVE
                     EAGPPLFFGFVAERLGLVMVDFMSLLFITSLFAALVSFHNAVARYLFSLGRDGVLPSG
                     LASVRERSGAPWAGSIAQSISAVVVIVAFAIAGTGSELGPLFPVVTLFSWLTNTGALG
                     LVLLMAVVSLAVIGFFRRDARDVGVGSRLIAPIIAFLALATVLVLIVANFNVLLDQAE
                     SNALTFVLPGLIVAAGIAGAVWALVLRVRRPEVYARIGRGAEQASAEHLG"
     gene            229628..230224
                     /locus_tag="MTO99_01000"
     CDS             229628..230224
                     /locus_tag="MTO99_01000"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44403.1"
                     /translation="MSTAVALLGAAVTAAAVALTLASAACTVVPVRHGGAVVRRERLA
                     AVVMVVSAVDMAVPAVQPVAPVVWGGLLAALALALLVVPRARPGTPERADLARHAGAL
                     LAMAGMWFAMTADASGPAIGGGHASHGGSGLFGLPFTAVVVVAALALAVAAPTPAAAT
                     MAHPPGRVRTPHTARWAAWRHPLMAVGMALMAVAMPLG"
     gene            230257..230562
                     /locus_tag="MTO99_01005"
     CDS             230257..230562
                     /locus_tag="MTO99_01005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018171802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44404.1"
                     /translation="MKTIQLRRYQLVDGTYDAFVAWWQEWMPRVRAEAGFGIEFAYGL
                     PETNEFVWAVSVDGDRAEFEAREAAYLPSAARAAAFEGQPQRVASSVIRIVEDVTAS"
     gene            complement(230549..231637)
                     /locus_tag="MTO99_01010"
     CDS             complement(230549..231637)
                     /locus_tag="MTO99_01010"
                     /inference="COORDINATES: protein motif:HMM:NF018028.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ family protein"
                     /protein_id="UOE44405.1"
                     /translation="MDRLMPGLIAILFGALVLLVVFVPLVALSYRRRGGFSAARFAGW
                     IALLFYAIGLWAYTLLPFPEPGSYTCVGAVLNPFEDVVDILRRQAAGESLLRNPALQQ
                     AALNVLLFAPLGVFARLLFGRGVVVATIAGAAVSLAIELTQLTGLWGVFSCAYRVFDT
                     GDLVTNTAGAIIGSLLAVPVVRRVQARRRPEAAPAASGPVSAGRRLLAMLADWLSSWL
                     LAGAAAVLVNAAVLALAGRDRLVEVGDTVSTWSAIVPIVAQLWSVLATGATLGEHATL
                     IEAVESRRPVLWWRLVRFGAGIGGYLVLAQLPAPFGLTAFGLAVASIVVAFTSRGHRG
                     LAQAAAGMDARGLVRSDDDTRRDATTTP"
     gene            231874..233358
                     /locus_tag="MTO99_01015"
     CDS             231874..233358
                     /locus_tag="MTO99_01015"
                     /EC_number="1.2.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019484128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016620 - oxidoreductase activity, acting
                     on the aldehyde or oxo group of donors, NAD or NADP as
                     acceptor [Evidence IEA];
                     GO_function: GO:0050661 - NADP binding [Evidence IEA];
                     GO_function: GO:0051287 - NAD binding [Evidence IEA];
                     GO_process: GO:0006006 - glucose metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="UOE46024.1"
                     /translation="MIPLIGGLYRDHGVVTSIHGRRLINRSPVDLLKAHRFARQAGDV
                     ELDPADTILVLEALRQLSPGPASIDVARLVARFRAAEAVGEASDLVAFLRSELASVLV
                     DAPGADALGADASGEPDASGAPQAATGTDVVLYGFGRIGRLLARILIAHAGGGQGLNL
                     RAIVVRKGSENDLQKRASLLRRDSVHGPFQGTIEVDEQRDTILANGTLIQVIYSDDPA
                     TVDYTAYGIRDAIVVDNTGRWRDEAGLAQHLRSTGVARVLLTAPGKGAIKNIVHGINH
                     ASIEPGDRILSAASCTTNAITPVLAAIDEAYGVERGHVETVHSFTNDQNLIDNFHSGD
                     RRGRSAVLNMVITETGAAKAVSKALPQLEGKLTGSAIRVPTPDVSLAILNLRLGRPAS
                     KAELNAYLRRVSLTSPLRQQVDYIESPEVVSTDFVGSNRAGIVDGLATIADGRDVVLY
                     VWYDNEYGYSCQVVRVIEAMAGTHPVVLPEREPVRVERAAAPVG"
     gene            complement(233567..234889)
                     /locus_tag="MTO99_01020"
     CDS             complement(233567..234889)
                     /locus_tag="MTO99_01020"
                     /inference="COORDINATES: protein motif:HMM:NF013799.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase family protein"
                     /protein_id="UOE44406.1"
                     /translation="MRSSNRSRSIAALVAAGALAFGCFSATAASATDDRSGAGGPGRH
                     HPHASADHVVLLALDGFDIDYLDRAPMPNLAHLLKRGSLTTSTGVMTSITNPSWASIA
                     TGAWPEHHLNTAFWYDEEAGVARGSSRDIAVPTIAEAIRDQGGTVASAQWFIVQDHGT
                     SYGDPEALYTQPGGTCERRVDDGVAVLTGKPVLSQGVEVTVPKIPDLTAVYCDTLDAI
                     GHDGGAEDPRIPGALQMIDEQIGRLVQAAKDAGIYGRTTFVITGDHGMTTFTNGFGAE
                     VLAAIADAGYQAEILSANQSPAADTDVVLTLGGVADVHLIGDAENDPDAAARITAAVE
                     GLPYIHAVYDKEAQQAMHMSPKHGELLIEPAPGWSWSTPSDGVSGRHGSTTEMEVPLI
                     LAGAGVRPNAKPVAPRHIDVAPTIAALLGYDAPAAAEGRVLKEAIRVR"
     gene            235254..237404
                     /locus_tag="MTO99_01025"
     CDS             235254..237404
                     /locus_tag="MTO99_01025"
                     /inference="COORDINATES: protein motif:HMM:NF024258.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ-binding-like beta-propeller repeat protein"
                     /protein_id="UOE44407.1"
                     /translation="MGAIGIGLGLTGAEWGPWPGAAVGAARADDTAPLRFAVFTDTHA
                     NLEETAMLANLTRVFAAVEAENPDFVLHCGDITDAGRESDFETYRSLIPAPLWDRIRH
                     VPGNHEIRWDITARERYQRWFGPTSYSFDAGGVHFVALDPTQALQEPGLFSDDLAWIR
                     DDLAAAGDTPSIMFLHYPLGDRNFFVNDADEFLRTIDPFPVRGIFAGHIHRNEVDRFN
                     GLTQVAAVTSRQDPFYLRVTERRDASGRAFVVELITLGATDADPVAIDLLAEIPLDSA
                     TGEGIGELRPKVRSNRDVVDVTAGRARAAVRAEAQVYPQGVFGAANAGDWTPLGTRGG
                     SWHGELDAAALAAGVHRVQVRAFDESGSFRYETATFERKSGHTSPGPWEVEIGGQLQG
                     ALAAAGDTVVAVSTSGTVAAVRIGHGRKPRTSWTAQLGPIHRGAAFSTDARTVYVPSA
                     DHTLTALGADDGRRRWRTDLARPVMSTPAVFDIGGEDRIVVAAGDRLHCLDAAGGTVW
                     TSEVPGMAAGRATSDGFRVFMGGGDGRGHAYDLATGAHLWSILTNDRVDTYRQLIYGP
                     WDDWTQVLPTGAVLFSTVTDAIATDPATGAELWRLAGGYLLAPGRVLDESNLLLATEW
                     GVVELVDPATGAKRWSSQAVPRLVNTGPVPHAKSASVWLVGAGGLVVSVDAASGAVTS
                     ERQLFTANTFSQPVIVGDTFVVGAQDGVLRGIRI"
     gene            complement(237418..238401)
                     /locus_tag="MTO99_01030"
     CDS             complement(237418..238401)
                     /locus_tag="MTO99_01030"
                     /inference="COORDINATES: protein motif:HMM:NF013224.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="UOE44408.1"
                     /translation="MDELDRRIVGALLASPRATNAQISEVVFTSEATVSRRVTRLIAT
                     GTARVIGVLDGEATRRTRSLFVRLRCRPGEVHRTAERLAAWPECGSVKLVTGSVDCVA
                     EISYTSNEHLLALTLAHLPALDGVLAVWSNQVIRRFATPHSWLPSLLTGDEVEQLRAQ
                     RLDPWHDPIPDGPAPTDALDDRIAAALAEDGRLGWQRLAELCDASPVTVRRHTESMML
                     SGALRMRTVVEPARIGLPVNAFVSLSVNPTQLGRAGQLLAEHPSVLMISATTGDRNLC
                     GEVALDSDAALYGFISDTIGGLPGLQHADVGVTLQSVKRAGRLVRAEAPAA"
     gene            238572..239960
                     /locus_tag="MTO99_01035"
     CDS             238572..239960
                     /locus_tag="MTO99_01035"
                     /inference="COORDINATES: protein motif:HMM:NF024808.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="UOE44409.1"
                     /translation="MAHLHTPLFAASVATVAAIALLAGCTSGGDTTEERQAAAGSVTF
                     WTPQTTPERLAAQEAVAAAFTEETGIEVEVVPMAGADQDQALVTGAASGDVPDVILHA
                     SAQTAAWNSQGLLDTEAAAATVDTLGADTFNQHALEAVTVGGEVAAVPSDGWSHLIVY
                     RADLFEQAGVEVPGSVAELAAAATTIKEQLGVTGLAFGTQAGSASATEGIQSLFQSAG
                     CELVDDGEVTIDSDACVDAAEHFLELRNSSVAGDFDATSARAAYLNGDAAMLLFSTHI
                     LDELAGLDEANPVTCPECGASPTFLADNSEFITVLDEDHPAQYGAVLSYGIPTGANTA
                     AAQAYIEYVLSTGYVDTLAVATEGRIPLRNGTADNPTEFIEAWGQLGIGAAQEKTTAE
                     LYGDEFVSQMADGINSIFLWGMGTDDAAIAGLVFSQGVLSGQIEQLYNGTSAAEVTAA
                     MRRAVEDVQASL"
     gene            239957..240913
                     /locus_tag="MTO99_01040"
     CDS             239957..240913
                     /locus_tag="MTO99_01040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012725351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="UOE44410.1"
                     /translation="MTTASHPRRARQLSRARRDNRNGLLLTAPTFAVVLVASIIPLIL
                     VIVFAFSEIRLVDIPRFGTEPIEWSLDNFARALDNPAFWQAMWTTLLFATLTMIGSVG
                     VGLALALALRRPFRGRGIVRALLLVPYVLPIIAAVTIWQTMLNPQYGLVNAFGRAVLG
                     WEAPIGFLNTTTSELWGIPIPLSLLVVVLFEIWRSAPLAFLFITARLQGVTPGIEEAA
                     ALDGANGRQITMRIVMPQLKGVILLLLLLRFIWTFQSFSEVYLLTEGAGGTQVMALKV
                     YTELITRADIGSAAAYGLLMSVILIALLAVYVVLARRKVDVE"
     gene            240910..241779
                     /locus_tag="MTO99_01045"
     CDS             240910..241779
                     /locus_tag="MTO99_01045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020015279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="UOE44411.1"
                     /translation="MTRRRSPLAPRPAAQVGRFVLIAVALVLSIGPVIYGILLSLRPY
                     SAVVQNPLDLLPSFDELDFSAFATAMLDESQGGFGLGRFVVNSLLVAIGTVVLSIVVS
                     IFGAYAAARLRYRGRGMMNAIILGVYLFPGIVLSVPLFVLLARAGLTGSLAGLFFVYV
                     AATVPVAIYMMRNYFLALPDSIEEAAIIDGASLPRMLRSVVLPIALPGVVATAIYVFM
                     IAWNEYFYALLFLVQDRDLWTAPLGIAQLSDFNVPVTVLLAGSITVTLPVIVLFFLAQ
                     RYLVDGLTAGAEK"
     gene            241779..243167
                     /locus_tag="MTO99_01050"
     CDS             241779..243167
                     /locus_tag="MTO99_01050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020015278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="UOE44412.1"
                     /translation="MAVQRIAIIGAGGRGRDAYGRWAIEHPDEARIVAVADIDPARRG
                     ALARAAGGAAEYGDWADLVAELGELAVDGVVIAVPDALHVDVAIAVADQGVPFLLEKP
                     AAPTLAELERLAAHQGRVSARLAIGHVLRFTPFWRSVKRIVDSGAIGRPMTIEVRENI
                     GFWHFAHSYVRGNWRRTDLSSAMVLAKTSHDLDLIRWIAGSAPETVYSVGELSWFRPE
                     NAPQGAPDFCLDGCPAADGCPFFAPRYYVDALAEVHGHPVHLLGSDTSSAGRLRSLRT
                     GDYGRCVFRSDNDVADHQQTVIEFPGGLTASLTASAFTAENTRNVAITGSEGQLTGHM
                     ESGELVVDLFSPLGRLPGGLPIAEHEQTAKPPMGHARHRIRVAMPSEQLGDHAGHAGG
                     DAALMAEFVAALGRGTVGTGELSFATALDSHLMAFAAEESRLTGSRVDFAAWVEGMDI
                     SGRADAAAGAGS"
     gene            243164..245341
                     /locus_tag="MTO99_01055"
     CDS             243164..245341
                     /locus_tag="MTO99_01055"
                     /inference="COORDINATES: protein motif:HMM:NF016945.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-N-acetylglucosaminidase"
                     /protein_id="UOE44413.1"
                     /translation="MKRPADFAEAVLGVVARSGGDGARVRVEEMAAGAGDAAAGGFEA
                     SGGLLTLRGTDAVAAASAYARYLHLQGRRITWEAPTLVPPFRAWPDAPATSFGTPFAI
                     RYHLNVVTHGYSTPFWTWERWERELDWMALHGVTHPLVLTAYEVVLEETLRRSGVGEA
                     EARAWVGGAPHVPWMSMGGMHDFGGPLPGSWGERRVRLARRILARARELGMIPVLPLT
                     GGHVPRSLAGPDAPEIEWQGWRTPALDPSSDAYAALVRTFLGVQREVLGDPGPNPVIA
                     VDPYIESVPPSGDLAALAAAGGGVHRAIAAAAPGATWLLQGWPFHYHRAFWTSERIDA
                     YLSEVPDESLLLIDLWGEHAPMWRGGMHGRRWLWTAVHNFGGRFALFGDLDGLARDVL
                     ELASERPARLEGVGLAPEAIENNTVYYELATDLVWGPVDPSTWVDEFAVQRYGLDDER
                     ARVAWRLLASTLYAPGRTRSIPSPVIARPWHAAAPFAAQRLAGEALPEPARMSANIDA
                     ENDPAVLGDLPRIARAARELAAISDLAPQRRALEHDVAELTGHVLAQQARVHIRGILA
                     AVAARDPAGVHDCLERLRADLLDLDALAATVPSSRVETWLDAARAWAETPEEAAIMER
                     DARSLVSVWGHQSSGLHDYSGRHWAGLVSGLYLPRWQAWAEWLAEAAGRGGSPDVEVL
                     RERVVAIEENWRAGGPTATAHRPTDGQADPVQTALAVLTRIGY"
     gene            245362..246537
                     /locus_tag="MTO99_01060"
     CDS             245362..246537
                     /locus_tag="MTO99_01060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010144116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiolase family protein"
                     /protein_id="UOE44414.1"
                     /translation="MVTEAVIVDVIRTPVGRGKPGGQLSGVHPVDLLAGVLDTLVNRN
                     DLDSALVDDVIGGCVSQVGEQSYNITRNAVLAAGFPEHVPGTTIDRQCGSSQQAATFA
                     AQAVLAGQADIVIACGVESMSRVPLGSSAQGADPYGSRIRTRYPDGLVNQGVSAELIA
                     QRWGFARDELDAFAARSHELAAAAGESGAFATEVVPVPGVDSLVDETVRPGTSVDSLA
                     GLNPAFRTDALAERFPELEWRITPGNSSPLTDGASAALIMSADAAEKLGLEPRARFRA
                     FSVVGSDPLVMLTGVIPATARVLDRAGLAHDDIDAYEVNEAFASVPLAWLADTGADAA
                     KLNPRGGAIALGHALGSSGTRLLTTLVNQLEATGGRYGLQTMCEGGGMANATIIERI"
     gene            246628..247431
                     /locus_tag="MTO99_01065"
     CDS             246628..247431
                     /locus_tag="MTO99_01065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family NAD(P)-dependent oxidoreductase"
                     /protein_id="UOE44415.1"
                     /translation="MELNGRGAIVTGGASGLGRGTAQVLAAAGAEVVIVDLPTAPGDH
                     VAAELADATGGSVRFAAADVTDEASVQAAIDLVRRRAPLRVAVNCAGIATAGRTVGRE
                     GPLDLAAFERTIRVNLIGTFNVARLAAAAMAANDPVESQALPGVPDTAERGVIVNTAS
                     VAAFDGQIGQAAYAASKGGVAAMTLPLARDLSKLLIRVVTIAPGIMRTPMMAGMPDEV
                     QRSLEEQIPHPSRMGTPAEYAALVRHIVENPLLNGETIRLDGAIRMQPK"
     gene            complement(247453..248439)
                     /locus_tag="MTO99_01070"
     CDS             complement(247453..248439)
                     /locus_tag="MTO99_01070"
                     /inference="COORDINATES: protein motif:HMM:NF038403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease prefix domain 1-containing protein"
                     /protein_id="UOE44416.1"
                     /translation="MTAASLTDRYVWAAARNVPEAQRADLQRELRERIGDAVDALVDQ
                     GHDATDAERAALTDLGDPGALAAAYVDRPFFLIGPRYYLVWWRLLKLLAAIVLPIIAA
                     VMVFVQLLTGATVGEAIGTVVSVTLTTAVHLAFWTTLVFAVLERTPAAEGQRGIDEPW
                     TVDRLPQLPDEVRPHRVSDLVASLVGLAVFAGLIVWQQFGGVILDGRGMPLLNPELWS
                     FWLPYFLVLIAVTAAFSVAIYAWGWTWWLALANLALQVAFTVPALWLLLTGQLVNPDA
                     LDAMGWPWGDSDEVIVPLIVTAFIAAAIWNVIDGAVKAWRAGGARREASVAR"
     gene            complement(248436..248789)
                     /locus_tag="MTO99_01075"
     CDS             complement(248436..248789)
                     /locus_tag="MTO99_01075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007927704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="UOE44417.1"
                     /translation="MNLRDETTAGHVQELRRGTVVLACLIRLRTPDYGYALLESLDAI
                     GIAVDANTLYPLLRRLEKQGLLTSEWNTDEARPRKFYRTSPDGEQLAAALTDEWHLID
                     RAISRLTDPTDGDES"
     gene            complement(248883..250325)
                     /locus_tag="MTO99_01080"
     CDS             complement(248883..250325)
                     /locus_tag="MTO99_01080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005048065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="UOE44418.1"
                     /translation="MKAGTPDLATLGHRIRHFRGERGLTLDQLGELVGLAGSQLSLIE
                     NGKREPKLSTLDALAAALDVQLADLLAREAPSPRAALELELGRAQASPLYQSLGLPPV
                     RPGRGISDETLAAIVGLHRELQRRASEAIATPEEARRANTELRERMRARDNHLPDIEE
                     LAEEQVRASGHRSGALTHREVSVMAERLGFKLIYVDDLPGSTRSITDLANGRIYLPPA
                     SIPGGHGLRSMALQAMAHRLLGHQPPASYDEFLWQRLQINYFAAACLMPQEASVAFLS
                     QAKKEKRLAIEDFRDAFGVTHEAAALRFSNLATVHLDMTLHFLRVNGDGALLKGYEND
                     GIPLPTDVTGSIEGQWVCKRWSARRAIEHTNRTTENYQYTDTPAGTFWCATQTGRTDA
                     TEFSITVGVPFNQAKWFRGRETTVRAESHCPDESCCRRAPDTLAERWAGQAWPSARLH
                     AHVLSPLPSGTFPGVDDAEVYAFLEAHAEQ"
     gene            250404..252410
                     /locus_tag="MTO99_01085"
     CDS             250404..252410
                     /locus_tag="MTO99_01085"
                     /EC_number="4.1.1.32"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017793611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004611 - phosphoenolpyruvate
                     carboxykinase activity [Evidence IEA];
                     GO_function: GO:0005525 - GTP binding [Evidence IEA];
                     GO_function: GO:0017076 - purine nucleotide binding
                     [Evidence IEA];
                     GO_process: GO:0006094 - gluconeogenesis [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase (GTP)"
                     /protein_id="UOE44419.1"
                     /translation="MQRTIPGHPPGRSKGSMMTISDLSAGTGASEYDGREASALREAG
                     LREAGLREAGLRQAALRQAQGAAGTTDRALAAWVAEIAALTQPDEIVWCDGSLQEADR
                     LTRQQVAEGKLIKLNPEWRPNSYLARTDPGDVARVEDRTFICSTYEEDAGPTNNWRDP
                     REMRDELHGVFAGSMKGRTMYVVPFSMGPLGGPISQLGVEITDSPYVVLSMGIMTRMG
                     EQVVRLIEQGEPWVRTVHSVGYPLVDAVGHRRAEVDWPCNETKYIVQFPDSREIWSYG
                     SGYGGNALLAKKCFALRIASVMARDEGWLAEHMLLIKITSPEGKAYHVAAAFPSACGK
                     TNLAMLRPTIPGWKVETIGDDIAWMRPGEDGRLYAINPEAGFFGVAPGTGESTNPTAV
                     QTLWGNTIFTNVALRPDGDVWWEGLTDAPPAELTDWEGRPWTPDSGRPAAHPNSRFTV
                     AAAQCPQISDDWDAHDGVPIDAILFGGRRATNVPLVAEARSWKHGVFMGATISSEKTA
                     AAEGTVGELRRDPFAMLPFCGYNMADYWGHWVKMGRILGEQAPKIFQVNWFRKGADGS
                     FLWPGFGENSRVLEWIVGRIEGTADAVEEPIGLLPAPGSLDLDGLDLSDETVAHLFDV
                     DPASWLAECDLTDEYFAQFGDRVPAALRAELASLRYHLERATQS"
     gene            252723..253112
                     /locus_tag="MTO99_01090"
     CDS             252723..253112
                     /locus_tag="MTO99_01090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017793929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1622 domain-containing protein"
                     /protein_id="UOE44420.1"
                     /translation="MEFGEAIQTVGEIIDVAGVVAIVVGVLYAFGDAAVRAVGRRGPV
                     YVRFRRVLGRAILLGLELLVAADIVKTVAVTPTLDSVIVLAIIVLIRTFLSWSLELEI
                     AGRWPWQRRTAGDEAEPSVAPRAADPA"
     gene            complement(253125..253826)
                     /locus_tag="MTO99_01095"
     CDS             complement(253125..253826)
                     /locus_tag="MTO99_01095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012300152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family NAD(P)-dependent oxidoreductase"
                     /protein_id="UOE44421.1"
                     /translation="MTGANKGIGYQIAAGLGALGWRVGVGARDRRRRDTAVQQLRAAG
                     ADAFGVPLDVTDDASVAAAAEFIAGHAGGLDVLVNNAAIVGGMPQTPSTVDPATVRTV
                     VETNVIGVVRVTNAMLPMLRASGAPRIVNMSSSVGSLALQTASGVDLGPVPAAYLASK
                     TFLNALTIQYVKELGDTGILINTGCPGFTATDLNGFSGDRTPEQGAAIAIRLATLPAD
                     GPTGGFFDDAGPVPW"
     gene            253810..254322
                     /locus_tag="MTO99_01100"
     CDS             253810..254322
                     /locus_tag="MTO99_01100"
                     /inference="COORDINATES: protein motif:HMM:NF015431.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR substrate-binding domain-containing
                     protein"
                     /protein_id="UOE44422.1"
                     /translation="MFAPVTSAIVAVEVMLCGPGEAESLLRNGRADVALLQRPYDPAA
                     GFDTEELRTEPQVVVLPAGHPLAGRDRVSGAEIDALTDLPLPRWPRVDGSYPDGPGPK
                     VRDLTQLTQSVALGLTCALVPESLGARLRGDHAVVPVPDAPAVTTVIAWPPHRRTRAV
                     ADLVGAAVQL"
     gene            complement(254329..254952)
                     /locus_tag="MTO99_01105"
     CDS             complement(254329..254952)
                     /locus_tag="MTO99_01105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018185525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator C-terminal
                     domain-containing protein"
                     /protein_id="UOE44423.1"
                     /translation="MPDATRPRAARKSPAERAAEIRDAARALALDGGLVAVTLRAVAA
                     RVGVAPALVAHYEPSMDELVAQTFRAITTDELADVVELVTGAGEASARSRVRALVATA
                     LDPARDDVTAVWVDAWSLGRRNPALAAAVRAVADGWQSQVARIVRDGIADGEFGADVD
                     ADAIAWLLVGIIDGLNAQSVVHDRHDPGRAEIVLRTIDRELGARPDV"
     gene            255078..256094
                     /locus_tag="MTO99_01110"
     CDS             255078..256094
                     /locus_tag="MTO99_01110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011776193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase family protein"
                     /protein_id="UOE46025.1"
                     /translation="MPAEAAPHERIWMAFPRPNQTLGGTVLEAEAAYAAWTAVAHAVL
                     EFEPVTMVVDPVERDRARRMLSAEVELVEAPLDDFWMRDIGPTFVVSDGGELGAVDWT
                     FNGWGAQPTAAWEHDALIGRFVGERSGAAVIASRLVNEGGAIHVDGEGTVLVTETVQL
                     DPHRNPGATRADVEAELARAIGATHVVWLPRGLTRDYEPFGTRGHVDMVAAIPSPGTL
                     LLHEQPNPEHPDHAVMRELRRFLEGETDASGRPWRIVDVPAPETLRDAEGFVDWNYLN
                     HLPVNGGVIACGYDEPRADARAREILGDAYPGRTVVTVDAREILARGGGIHCITQQQP
                     AVGG"
     gene            256091..257806
                     /locus_tag="MTO99_01115"
                     /pseudo
     CDS             256091..257806
                     /locus_tag="MTO99_01115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012630797.1"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
     gene            complement(258255..259040)
                     /locus_tag="MTO99_01120"
     CDS             complement(258255..259040)
                     /locus_tag="MTO99_01120"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44424.1"
                     /translation="MTLLDHAPARLAAPPRDLLDSLAGPIDAADLLPADALGDGFDAV
                     QGRVRDWLRHWDAVPVPAFEPVRETHPAEERRSSLNALPTRADGAARFTASVYDPPAR
                     DDAPLSWSRSWASVVRLPEAIEDGRLHYRFAVGSRLVLDGQAEVSLVSTSVHFGAVPD
                     ARVASPFDAPGFRTPLARPLVGVQARDDADADASQSFEGSLDVKAGDAPAFAFVLGVD
                     VLMRGGWIRVHDGSSTWVGPAGAGATGTIETRFTPAPLLAMFG"
     gene            complement(259177..261066)
                     /locus_tag="MTO99_01125"
     CDS             complement(259177..261066)
                     /locus_tag="MTO99_01125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018189972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein/permease"
                     /protein_id="UOE44425.1"
                     /translation="MTQSETPATRRSPFTRRADRGGPRATVRQLIPYLLEHRGVIAVV
                     IVLSLLLAAASLAQPLVVSRVISVVEASEPLGGLVWLLVGLVVAQGLLSGYQHYLLQR
                     TGEGVVLTSRRQLIARILHLPIAEFDTRRTGDLVSRVGSDTTLLRAVLTQGGVEAIGG
                     IVTFVGAIIAMAIIDPVLLGLTVLVVAVALGTAGLLSLRIRDASRQAQERVGALAAAV
                     ERSISSVRTIRAAGATEREIAATTEEAEGAWKMGVKVAKISALVVPVAGIAMQVSFLV
                     VLGVGGYRVASGAITVANLVAFILFLFMMIMPLGQVLGAFMAINQALGALGRIQEILD
                     LPDEDAGDRALAPLAIMVGPANETVLPHAPAIEFDDVSFAYARTRPNDPADPGNASPD
                     AFAPEPDVTDRQHVLRDVSFRVPRGQRVALVGPSGAGKSTILSLIERFYDPSVGSVRL
                     GGLDLRSLDRAELRAQIGYVEQDAPVLAGTIRDNLLLGSPNADDAQCEHVLRAVNLGA
                     VLERDPAGLDAQVGEDGIMLSGGERQRLAIARALLAAPPILLLDESTSSLDGVNERMM
                     REAIDAVAAGRTLLVIAHRLSTVIDSDRIVVLDQGRVIGEGTHGELVETVPLYRELAE
                     HQLLV"
     gene            complement(261155..261382)
                     /locus_tag="MTO99_01130"
     CDS             complement(261155..261382)
                     /locus_tag="MTO99_01130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018189973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44426.1"
                     /translation="MDDRTLRTAIAAADGDDPYRALRDIRHARIELTRELDRAEAIAV
                     RRARAAGASWQLIALALEVSKQAVHKRYGRG"
     gene            complement(261458..262345)
                     /locus_tag="MTO99_01135"
     CDS             complement(261458..262345)
                     /locus_tag="MTO99_01135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013492000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PfkB family carbohydrate kinase"
                     /protein_id="UOE44427.1"
                     /translation="MRSPAEPVLAVVGDLVEDIVVWTSEPVRHGTDTAARVFRTRGGS
                     AANVAALASGAASARVRFIGCVGPDAAGDALVAALERDGVDVRVQRRGTTGAVVLLVD
                     PEGERTMFPDRGASAELGPIDPSYLDGVSWLHVPLYGFERDPARSSVLGLLALARERG
                     AGVSVDASSTGLLASLGIEEVAAMLRELAPEVLFANETEAEALGLAAGGPAAAAVAAT
                     VVVKHGPDPTTVFERGRPTLRVEVEPVDVVRDLTGAGDAFAAGYLAATLAGAAAHEAV
                     LAGHALAARVITTAGATPM"
     gene            complement(262329..263255)
                     /locus_tag="MTO99_01140"
     CDS             complement(262329..263255)
                     /locus_tag="MTO99_01140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006503884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine-5'-phosphate glycosidase"
                     /protein_id="UOE44428.1"
                     /translation="MPDAVSPSPAIRVSAEVRTALAEGRPVLALESTILSHGLPRPRN
                     LEVGLAAERQVRDAGVVPATIGVIGGEAVVGCSAGELERLCTVDGVVKASVRDLPIAR
                     AKRLDAGTTVAATAWLAHRAGIRTMSTGGLGGVHRGASETFDESADLPVLADTPITLV
                     SAGVKSILDIGATLERLETLNIPVVGYRTNRYPAFYVTDSGFELDYRVDSPDEVAALA
                     RARDELGQRAAVLVANPVAAEAQLDPAEHDRILAAALAAAAEAGVTGHDSTPFLLDWV
                     QRATGGRSLAVNLEVYRGNVALGAEIARAIAG"
     gene            complement(263307..263621)
                     /locus_tag="MTO99_01145"
     CDS             complement(263307..263621)
                     /locus_tag="MTO99_01145"
                     /inference="COORDINATES: protein motif:HMM:NF015925.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="UOE44429.1"
                     /translation="MFIHMSIHRPKPEHVDDLIASMNLVRLGGIGTQGLLQIGPWREV
                     DGGERVVGIAIWESRRHWEEHVEEVFAVVADHPFDEWEAAPVERILLDDVGAMPGNPE
                     EI"
     gene            263724..264077
                     /locus_tag="MTO99_01150"
     CDS             263724..264077
                     /locus_tag="MTO99_01150"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44430.1"
                     /translation="MSHRQSHPATQPLAGRAMGMRGCEAHAECASDRPGHRLHRMQAR
                     LAEVAGSKWVDAIVVGAHDDGFVELAALDGRRIDRVWHHAPLGDVLEPGEPVALHSVY
                     GVLDSVAGRFSIAEA"
     gene            complement(264155..264304)
                     /locus_tag="MTO99_01155"
     CDS             complement(264155..264304)
                     /locus_tag="MTO99_01155"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44431.1"
                     /translation="MAMCRACSAECMMHAEMSEHCRMCAMACDQAAMALEKMLGSMRE
                     MAPAM"
     gene            264297..264668
                     /locus_tag="MTO99_01160"
     CDS             264297..264668
                     /locus_tag="MTO99_01160"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44432.1"
                     /translation="MAIVLSIIDIMSAMSQPFMRSIIRIMVPHMSAQFAHIAAHRPMP
                     SPASASAHITHACMHAERASRHSSIIDMSMPFGMSDADIAPFIMSIVMFITGDRRSRA
                     TGYRRRRWMARWPCCGPCYVV"
     gene            complement(264838..266280)
                     /locus_tag="MTO99_01165"
     CDS             complement(264838..266280)
                     /locus_tag="MTO99_01165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013583728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MHS family MFS transporter"
                     /protein_id="UOE44433.1"
                     /translation="MSATQTAPAAAAPSPSTVKNSRGRVILASLIGTTIEFYDFYAYA
                     TAAVLVFPTLFFPTGDATTALLASFAVFGAAMVARPIGAVVFGHFGDKHGRKATLVAS
                     LLTMGIATFIIGLLPTYGQIGWFAALALLVLRLAQGFALGGEWSGAALVATENAPEGK
                     RAWYGTFPQMGAPVGFIIANGLFLLINFLAPSSEWFLEWGWRVPFLFSAVMVIIGLWV
                     RLKLVESSAFEKVTTKGAVRKVPLGTVFRYHWKELILGTFFMLATYVLFYLMTSYTLA
                     WGTKPADVETAQAKADAAGAAFDPAAFYPGGGFAYPDFVTMQIIGVVFFGVFTLLSGP
                     IADAVGRRRLLIWVTAAIIVFGFTFNVFLLPAADPRFAGALAQAFLIFGFTLMGATFG
                     PMGALLPELFPTNVRYTGSAVAYNVSSILGAAVAPFIALALWALVGEPWLVGVYLSAM
                     GVLTLISLLLGKETKDVDYEDAGFTSSAVL"
     gene            complement(266527..266880)
                     /locus_tag="MTO99_01170"
     CDS             complement(266527..266880)
                     /locus_tag="MTO99_01170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018188802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S protein"
                     /protein_id="UOE44434.1"
                     /translation="METLRHIVVFIHLIGFAVLFGAWAVEAVSRRFKVTRLMDWGLLI
                     AGVAGLALAAPWGISYDLNYVKIGVKLVVLIVIGALLGIGSARQRRTDSVPPVIFWSI
                     GVLTLLNAGLGVIWR"
     gene            complement(266958..267452)
                     /gene="ribH"
                     /locus_tag="MTO99_01175"
     CDS             complement(266958..267452)
                     /gene="ribH"
                     /locus_tag="MTO99_01175"
                     /EC_number="2.5.1.78"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018171857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0009349 - riboflavin synthase complex
                     [Evidence IEA];
                     GO_function: GO:0000906 - 6,7-dimethyl-8-ribityllumazine
                     synthase activity [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="UOE44435.1"
                     /translation="MSGKGAPRFLSPSEDDVDGTGLEVVIVAGSWHDEITDGLIAGAT
                     RTLEASGASFSLVRVPGSFELPVVAKAALEAGADAVVALGVIIRGGTPHFEYVSSAAT
                     DGLTRVALDTGKPVGFGVLTLDDEQQGLDRAGLPGSKEDKGREAAEAAIVTALTLRAL
                     SRGE"
     gene            complement(267449..268750)
                     /gene="ribA"
                     /locus_tag="MTO99_01180"
     CDS             complement(267449..268750)
                     /gene="ribA"
                     /locus_tag="MTO99_01180"
                     /EC_number="3.5.4.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017203980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003935 - GTP cyclohydrolase II activity
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase II"
                     /protein_id="UOE44436.1"
                     /translation="MSLAAIPEVLDALRAGKPVIVADDEARENEGDAIMAAEFATQEW
                     IAWMVRHTSGFLCAPMPAAFADRLELPPMVERNEDARGTAYTISVDAANRNSTGISAG
                     ERAHTLRVLADPESTPDALIRPGHVLPLRAVDGGVRERAGHTEAAVDLMRLAGLSPVG
                     VIGELVADDGEMMRLPQLIELGDREGLPVTTIAALIEYLQTWHAGRDLDAPVPQVVAE
                     TSRVLFEVETTLPTVHGEFRVRAYRDRSTGADHVAIIAGDPAADPAGAVVRVHSECLT
                     GEAFGSLKCECGPQLDAALEAIRADGGVVVYLRGHEGRGIGLINKLRAYRLQEDGLDT
                     LDANVALGLPIDARDYTAASAILDDLGIERVRLLTNNPEKVRQLEQRGIRVAERLPLV
                     VGVGAGNQGYLDTKRRRMGHSIDDGQLADAAAESLLEGHAS"
     gene            complement(268747..269445)
                     /locus_tag="MTO99_01185"
     CDS             complement(268747..269445)
                     /locus_tag="MTO99_01185"
                     /EC_number="2.5.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019179420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase"
                     /protein_id="UOE44437.1"
                     /translation="MFTGIIEERGSVTRVERTADAARLTVRGPLAVEGVKHGDSISVS
                     GVCLTVVDFDDASFTADVMAQTLAMSTLDDARAGLAVNLERAAKVGDRIGGHIVQGHI
                     DGTAEVLEIRPGEAWRVIRFSLDPAHAPLVVDKGSIAVDGASLTVSAVGDDWFEVSLI
                     PETLAATTLGERAVGDRVNIETDILARQVERMLRFDAHRSLPSSPAAPGAPAAPAAPG
                     APAPEPSVVEGSPA"
     gene            complement(269447..270517)
                     /gene="ribD"
                     /locus_tag="MTO99_01190"
     CDS             complement(269447..270517)
                     /gene="ribD"
                     /locus_tag="MTO99_01190"
                     /EC_number="1.1.1.193"
                     /EC_number="3.5.4.26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019179421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008703 -
                     5-amino-6-(5-phosphoribosylamino)uracil reductase activity
                     [Evidence IEA];
                     GO_function: GO:0008835 -
                     diaminohydroxyphosphoribosylaminopyrimidine deaminase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase/5-amino-6-(5-phosphoribosylamino)uracil
                     reductase RibD"
                     /protein_id="UOE44438.1"
                     /translation="MTAHEATAIEIAAMRRALELAERGPAAGVNPRVGCVILSPAGDV
                     LAEGWHRGAGTAHAEVDALSHLRSGQARGATAVVTLEPCNHTGRTGPCAVALLDAGIG
                     RVVYAVGDPGDHSAGGAEHLRDAGVEVVGGVLGAEAEAFLDDWLFAARHRRPHVTVKW
                     ASSLDGRAAAADGSSQWITGEVARADVHRRRALADAIAVGTGTVLADDPALTARDAAG
                     RLLDAQPVPVVFGTRPVPADAAVLRHPRDAVLLSGHDLVADLHLLAERGIRSLFVEGG
                     PTLASAFLAAGLADELLVYLAPALLGGPRLAVADLGIATIADARRYDFTDVTRLGDDL
                     LVVARPNPSRAPRPSASPTEGT"
     regulatory      complement(270594..270736)
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:14.4:RF00050"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="FMN riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="flavin mononucleotide"
                     /db_xref="RFAM:RF00050"
     gene            complement(270879..272180)
                     /locus_tag="MTO99_01195"
     CDS             complement(270879..272180)
                     /locus_tag="MTO99_01195"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44439.1"
                     /translation="MDPATEVERSLDAEPADTSPADTPPAGTPAAQPGSATPAGDAAA
                     SGTPVAEPRHAPRARRGALTALVVAAAVIGLGLAGFVQHVVATELHARFWQGWSVAAG
                     RLDESSAAFARQVDRGGSDLLRAESLQAVFTPALIPDADAAAFGDDVDRLRDALASDP
                     AGPVASDTGLIGTDRFAFPWERYAEIARLFELVPDRHAAADRADEAASELGDVRTAVH
                     EASDGIFDTAFEQAEAQLAAYPAATNRARLDLQYRLDGDFLTSAPDGTAPVLTELAQM
                     VEALRVSHEAEQARRADPSYGVRGEIEAFAASLSNGVALDFAWAYEVAGKPSDGWFAG
                     TADFAMDGDEWSLITLSFSIADAWRDPDAEAVVVHEVGHTQVTRDACRAIFDGPEFAG
                     TDHEMWATAWAIGMGYDRPGAGIQAYGRPTDAQIAAASACR"
     gene            complement(272536..273264)
                     /locus_tag="MTO99_01200"
     CDS             complement(272536..273264)
                     /locus_tag="MTO99_01200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="UOE44440.1"
                     /translation="MTLPAAVLFDLDDTLFAHRGAVARGILTHLDAVGIVTPDADAAI
                     ADWHRLEELHYHRYLAGELAYEGQRRARAREFAASHGVELTDDEAGEWFTAYFEHYRA
                     AWTLHDDALACLDALRAKRGDIRFGLITNGDLEFQQRKVAQVGLDRLVDLLVASGEVG
                     IVKPDARIFHHACELLGIEPADAAYVGDRLRTDAIGAAEAGLTGVWLNRVGAVVEPAD
                     AARAADLGVLEITGLAELPAALAR"
     gene            complement(273261..273704)
                     /locus_tag="MTO99_01205"
     CDS             complement(273261..273704)
                     /locus_tag="MTO99_01205"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="UOE44441.1"
                     /translation="MPPVSLRTARLVLDRPSPDDVDVITLAGQDPPFERYPTIPWPNA
                     RDHAGLGSWAAAPHRGQGFMAEAVRAGVDRAFDLAWPTVTWQALVGDHAAAATARNVG
                     LAFAGIGPGVLPRRDGSTSIRRHRAVTPETDPAAARSSWPAETCA"
     gene            complement(273713..274723)
                     /gene="trpS"
                     /locus_tag="MTO99_01210"
     CDS             complement(273713..274723)
                     /gene="trpS"
                     /locus_tag="MTO99_01210"
                     /EC_number="6.1.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009774042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_function: GO:0004830 - tryptophan-tRNA ligase activity
                     [Evidence IEA];
                     GO_process: GO:0006436 - tryptophanyl-tRNA aminoacylation
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan--tRNA ligase"
                     /protein_id="UOE44442.1"
                     /translation="MNTARPVVFSGMQPSSDSLHLGNYLGALVNWVKLQDEVDPIYCV
                     VDLHAITVSQDPAELRASTRRTAAQYLAAGVDPLRSTLFVQSHVPAHAELAWVLGTIT
                     GFGEASRMTQFKDKSAKQGADATTVGLFTYPVLMAADILLYGTDLVPVGDDQRQHLEL
                     TRDLAGRFNSRFGETFTVPEAYIPKESARIYDLQEPTAKMSKSAASDAGLIRLLDEPA
                     RTAKKIKSAVTDTERDIRYDPAAKPGISNLLDIYATITGTPIADLEAQYAGRGYGDLK
                     KELADVVVGALEPIRTRTFELLDDPAELDRILAVGADKAAERAERTLATVYERVGFLR
                     RR"
     gene            complement(274739..275575)
                     /locus_tag="MTO99_01215"
     CDS             complement(274739..275575)
                     /locus_tag="MTO99_01215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III"
                     /protein_id="UOE44443.1"
                     /translation="MPSKPLRIATVNVNGIRAAYRRGMGDWLAGRGVDILALQEVRAS
                     TDDLTGLLGDDWDIVHDPATAKGRAGVAIASRHRASLHRVELGGPDFDTAGRWLEADY
                     EVGDRVVTVVSAYVHTGEADTPKQVEKYRFLDAMEQRLPELAAHSELAVVLGDLNVGH
                     RTLDIKNWRGNRKNAGFLPDERAYFDRFVGAEGDELANRGAGLGWVDVGRRFAGEVDG
                     PYTWWSWRGKAFDNDTGWRIDYHLATRALADTVETYTVDRAAAYDERWSDHAPVVVDY
                     AI"
     gene            complement(275586..276908)
                     /locus_tag="MTO99_01220"
     CDS             complement(275586..276908)
                     /locus_tag="MTO99_01220"
                     /inference="COORDINATES: protein motif:HMM:NF015587.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YihY/virulence factor BrkB family protein"
                     /protein_id="UOE44444.1"
                     /translation="MSDGRRSNGRRGAPAPDSPAGGVDRVRPAGEASEPVDDRPDLRD
                     RIEDLRQPLRERFDPQIRTVTTITKKTLALFPVRVWRHFLAQNGFILSAGMSYQSLFA
                     VFAGIYVVFAVAGIWLTGSAPAMTAFVTLVNTYAPGLIGDENAVISQSALEQIAQSSS
                     GVLGWTGVIALAGFIWTAIGFVTYARIGVRSMFGLPKDSRSYLLLKARDLVAAMAFGL
                     VLLLASAMSIVTVNFIDWTLDLLGWDFASRWSTYFLQGGALLVVFTIDTLAIAALFRF
                     LSGAAMPWRRMWAGSLLGSAGLSLLQLFSSVVLAFTTANPLLATFAVFIGLLLWFRVT
                     SIVILVAASWVAVEAADAHESLRLVTPAQLAAERAARERAALITAAEVRVREARDEFE
                     ATGWLGRIPARHRLERAEAELERVRASGTDGADGEEAPAGRRDVRGLP"
     gene            277184..285046
                     /locus_tag="MTO99_01225"
     CDS             277184..285046
                     /locus_tag="MTO99_01225"
                     /inference="COORDINATES: protein motif:HMM:NF039608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44445.1"
                     /translation="MTFPQHLPQAARSRRARREQERRRRRGLSAAVASLTVGALLLLG
                     VPTTAFAEEPVGDGTAAVATADDGAQDSGASAPAAPTEGAGDSTPPAEAPNDEPPAGE
                     PPAGTPPETRDGEEPGVDDPGASEPGAEQVSSDPADPLPGLSAPEIGPTALVVTPDGT
                     GTGTGPDPGVNQAKVIANVSGDRNAADTAIVGVAGVTVGFWNQNQPGTWDGPPVATCL
                     TDANGQCWALSTGTTGAERAVRAAIVDVPEGWRINTSLVTGLNNGSFQQTPYSVVNTG
                     NLGSGQTIEVPPSGAGRTTSTGDWLLSRANPGLPQICGLNIGLLVDLSASVDAAGAQQ
                     DLRNAAAGFVNALAGTPSQVAIHTFGTLSPAAGSNATVNAANSSIGLTPTSGAGLTTL
                     LNKANGLITGIQPAQYTNWDRGLWSYFPDREALDVIVVLTDGNPTRYDSPATGAGIDT
                     RFIEMEHSLASANALKASGVAMYSVGIGAFDDPDNLIAVSGPIEGSDWSTVDDYAELA
                     ARLQARASEVCGGTVNVTKQIVSSDGQTVTDGFGWQITAESTEGEPIVKLDQVGEDYA
                     VSADGTTNPSVGFRIDFSDVAPSHRLRITETPQNDFDLLPFDNGDNMRCDTASAPGEW
                     LDVENIENGVLVDALFEQTVRCTIRNQAVEQQADLRVDKLWRIDADGDGVYEEFADGQ
                     TLPIAASASLQLAGNDDLPAGDGTYAFGVVVPNLRVDSTVEISETVQVPLLCTNTASY
                     APQLNNGEFTLTQPQPAVNVVTLTNTVTCETRLTLAKSPQGGPAEPDEWSLDALPNPG
                     PTQPQNPLEFAAGVNGVTHEITPASVYALAEDPTTENAELYFQEFAPTFAEVVDEPGV
                     LQWDSNAAAGATGTWFCVLATGVDGQGAPIFSTTRFDGLNGGVNVPAGNWARCTATNF
                     LKPTIELQKWIDLDGDGEPDTQDGADQWTLTAGDWVAPTVTNGVQTHTMPGDQADVSG
                     AGGFPATAVMPGGYTLSETDAPDGYVNGTVWECSEDGGAFAAIEGDDVTVESGHALVC
                     RIVNSAVSPTIELRKLIDPNSPGGDANDWELSAAQGGTVFGPAAGHLPVTEVAIGEPI
                     VLTEEPAADFEHADEWEAAGPWECSIDGGDDFELQDGVLPALGAGDDASCTITNRLKP
                     FTPTVHKDVVSLTPQDDGSWEIVYEIVVENPSNFASVDYEIDDQLDFGGEITISQATY
                     QPPGSVTDTPFDPDTGFTAGGTVAPIGSDPNPAVWTVTVDAIVDAGAFTPQNVQCQPG
                     EQPGAGGFLNTVDLLVDDEVVDHDDACAEPVLPEIEKLGGTAVDHGDGTFTLPYTITV
                     TNPSPDTAVVYDLEDALDLPADVEQVGDAVVTAAPAGVTPVDGWTGVAPNTLLAEAVE
                     LEGGAAAHVYEIEVVVRLDSADGAFGCPDENGLNNVATLHSGNQEQDATGCVEIDVPD
                     IVHDKSVVADSVSQASDGTWTIAYEILVENLDDELGGLYSLADDLHFGTGNDASGATF
                     TVTRDGLPYATSWAGSGDLVVDEYLAGGASVTWGILVEGIVVEGPQLTPAQTACPQTD
                     VDGAFNNAAILTVGGDDSVDTACSEPSAPQVAKTGATAVQRDDATWDVSYLLTVTNTS
                     AGAKPGIYTLDDEPAFPGSVTVNSYTIERIDPDPTVLADDVSPVPDTIPVVPTTEIEA
                     GGEHQYRITLNVTVPAGLPADERLCVPGEPGTGFFNGTTLTSGEIVDTDDTCTDIEEG
                     GVPTVVKDDPTVTQAGDGVWTVEYQVTVTGNEEFVSTYTLSDTLRFGPSIEILSAAWS
                     GEGESGSWANPTDDPTTVIVATPTPIGIDEVHTYTVTVTAAVDAAAFEDPDTTTCAAW
                     EGAPNVGFLNVIRLVSDGAVQTDEGCGVPAAPEILKTTVGDVVKVDDGADAYHWEATY
                     ELTVTNSSDTQALVYDLIDAPDFADGVTITDREATSADVAVDPDWNGAEPTTDTIVAD
                     QELPAGATHTVTVTVSFTVADVPDDPSLLCEGEGGQGLLNGATVVSGGEWRSEACFDV
                     PVVVVLDKFWVIDGGEPIPNGEVPGFDAQAVLDEDQVDWGVENGPYALGDTVGIAETE
                     VEIDPTCLYVGATGLGQQTLDRTVNTYDVINEADCDYDVGIEKTHELDEGETAVESGD
                     AFTWVLTVTNLDRDVTDLEVTDLIDPTLAVTGPATFETDPAVLPGVWAQTSGDTDSAF
                     AASYTGLYPSGAVTTIRIPVLMLPEAPIETPPAVDPNAPPPEVPPLDTAPIPNTACVA
                     VTGEDPARDRDPGPDCADDEVPVKRIQPAAYVRCIADVPWLYFDIQTTDNVDPAPITV
                     TWTSADGSLVKTEQVPWDARNGRLVWPGAAIAENGVPFEFPGWRPITEADLENPDSVV
                     PGYRFLDLILDETSPTFPWRGETYTPTGDPTDPYTVTKEPLSVTFSINPSQSVLAVYP
                     QALPACALDRPPAVVIDKTASVASTTPDADYSYSLQVTSTGIGAAQPVTLIDEIPSHL
                     RVDAITTAGAPAFPRWENCDVTGEDSAGYGGTLRCDLYGVLGPSYPEAPVVDLAVHVR
                     PGTTVSSIANTGEVCWSEVQGDGTIGAEVICGEDTVTVSLPKPLARTGFQGGVLGYAG
                     LLVLLGGLVVAIAAIRRRREGPVG"
     gene            complement(285207..285968)
                     /locus_tag="MTO99_01230"
     CDS             complement(285207..285968)
                     /locus_tag="MTO99_01230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase iron-sulfur subunit"
                     /protein_id="UOE44446.1"
                     /translation="MSTATLEQPPAAEAPVQSFTVTFLIRRFDPDVDTEPHWQDFDVQ
                     MYPTDRVLDALHKIKWEQDGSLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDLDIS
                     KPIYVEAIKGLPLEKDLVVDMEPFFASYREVQPFLQASTTPEPGKERVQSVAERARFD
                     DTTKCILCAACTSSCPVFWTDGQYFGPAAIVNAHRFIFDSRDDEAKVRLDILNDKEGV
                     WRCRTTFNCTEACPRGIEVTKAIAEVKQAVLRGRP"
     gene            complement(285970..287775)
                     /gene="sdhA"
                     /locus_tag="MTO99_01235"
     CDS             complement(285970..287775)
                     /gene="sdhA"
                     /locus_tag="MTO99_01235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016627 - oxidoreductase activity, acting
                     on the CH-CH group of donors [Evidence IEA];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     GO_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA];
                     GO_process: GO:0022900 - electron transport chain
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase flavoprotein subunit"
                     /protein_id="UOE44447.1"
                     /translation="MTSETHAETKVVDGVHYHQYDIVIVGAGGAGMRAAIEAGPGAKT
                     AVISKLYPTRSHTGAAQGGMAAALANVEEDSWEWHTFDTVKGGDYLVDQDAAEILAKE
                     AIDAVIDLENMGLPFNRTPEGKIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTL
                     FQNCVKLGIEFYNEYYALDLIMTEVDGVPQPSGVVAYELATGELHVFQAKAIIFATGG
                     FGKIFKTTSNAHTLTGDGVGIIWRKQLPLEDMEFFQFHPTGLAGLGILLTEGARGEGA
                     ILRNASGERFMERYAPTIKDLAPRDIVARCMVQEVAEGRGAGPHKDYVLLDCTHLGAE
                     VLETKLPDITEFARTYLGVDPVYEPVPVMPTAHYAMGGIPTNVAAEVLRDNDTVVPGL
                     YAAGECACVSVHGSNRLGTNSLLDINVFGKRAGRNAVEYVKTADFPPLPDDPAKEVRE
                     LLQGLRDGTGTERIAAIRKELQDEMDRNAQVFRTDESLAHAAGVIGELRERYKHIAVQ
                     DKGKRFNTDLLEAVELGFLLDLAEVVVHSARNRKESRGGHMRDDFPNRDDENYMQHTM
                     AYLAGDAHSSDASDHIRLDWKPVTVTRYQPMERKY"
     gene            complement(287783..288214)
                     /locus_tag="MTO99_01240"
     CDS             complement(287783..288214)
                     /locus_tag="MTO99_01240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013772017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase hydrophobic membrane
                     anchor subunit"
                     /protein_id="UOE44448.1"
                     /translation="MTALSFPGEPRRRRTNWEKWGWIYMRASGVVLVVLVFGHLFVNL
                     MVGEGVKAIDFGFVGGKWALPFWKWWDCLLLWLALIHGANGMRTLVNDYTNPGTVQRI
                     LKGALLVAVVVLLTLGTLVIFTFDPCPAGSPAELLPSFCAA"
     gene            complement(288225..288644)
                     /gene="sdhC"
                     /locus_tag="MTO99_01245"
     CDS             complement(288225..288644)
                     /gene="sdhC"
                     /locus_tag="MTO99_01245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017883865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0045282 - plasma membrane succinate
                     dehydrogenase complex [Evidence IEA];
                     GO_function: GO:0000104 - succinate dehydrogenase activity
                     [Evidence IEA];
                     GO_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase, cytochrome b556
                     subunit"
                     /protein_id="UOE44449.1"
                     /translation="MPGTQAGTLTAPTPAKERPGGTLYRGREGMWSWVLHRITGVAIF
                     FFLLVHILDTALVRVSPEAYNAVIGTYQTPIMGLGEVALVAAIVFHAFNGIRVILVDF
                     WSWATRHQKLLFWIVIGLWVVTMLGFAPRHLMNVFSH"
     gene            288867..289985
                     /locus_tag="MTO99_01250"
     CDS             288867..289985
                     /locus_tag="MTO99_01250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013583714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate nucleotidyltransferase"
                     /protein_id="UOE44450.1"
                     /translation="MHDAQLDRFYSVIPAGGVGSRLWPLSRADAPKFLHDLTGSGQTL
                     LKDTWDRLAPLSGEQRIMVVTGRAHRAAVEAQLPALADANIVLESEPRDSTAAIGLAA
                     AILHRREPDVIVGSFAADHVISGEALFRAAVEQAVAAADAGYIVTIGITPTEPAVGFG
                     YIECGDDLDVPGTEHVEAVSSFVEKPDLATARRYLADGKHLWNAGMFIARADVLLAEL
                     ARTKPDLHAGLVELAAAWDDPSTRGPAVDRIWPKLEKIAIDYSVAEPAAAAGRLAVVR
                     GHFQWDDVGDFASLAKLNTAGRSGELAILGENARVLADASSGIVVSRAKRVISLIGVK
                     DIVVVDTPDALLVTTSEHAQRVKAVVDALRLGGSSDVL"
     gene            290001..291062
                     /locus_tag="MTO99_01255"
     CDS             290001..291062
                     /locus_tag="MTO99_01255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BMP family ABC transporter substrate-binding
                     protein"
                     /protein_id="UOE44451.1"
                     /translation="MPRSAHRLAPLTIIAASVALLAACSAPPPSATTRPGDVCARMVT
                     NSGGLEDRSFNQSSWEGLKQAKDELGVTVLALVSTGETDLAPNVQQAVDSGCQLVVTV
                     GWELAEATADQATKNPDVSFAIVDEVVEADNVKPVVFDTAQASFLAGYLAAGVTKTGV
                     VATFGGGNQPPVTLFMDGFVDGVAAYNAAHGTQVIALGWDKAAQDGAFTGDFEDINKG
                     KVLTEGFIDQGADVILPVAGQVGEGAAAAAVERGEVSVIWVDSDGFETLPAEFRPVIL
                     TSVLKNTQQAMLEIVGDVLDDEFTNEPYVGTLENGGVEIAPFHDLASLVTPELEAEIE
                     ALRQQIIAGELVVESPSRP"
     gene            291208..292305
                     /locus_tag="MTO99_01260"
     CDS             291208..292305
                     /locus_tag="MTO99_01260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010205714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BMP family ABC transporter substrate-binding
                     protein"
                     /protein_id="UOE44452.1"
                     /translation="MTFTTKKTAVSGLALVGAAALLAGCAAAPDESTDGAGEGLDFLP
                     CMVSDAGGFEDRSFNQLGFEGLQAAADELGVEYKAVESASETDYASNLSSLVDQGCNT
                     IVTVGFLLAPAALESALANPDIEYVSIDDPVDQDFDGVTDAENIKPIIFDTAQAAFLA
                     GYLSAGVSQTGVVGTFGGMNIPTVSIFMDGFAQGVDFYNEENGTAVKVLGWDRAAGDG
                     SFTGGFEANDGARQIAQGLIDQNVDVLLPVGGPIYQSAAAAITDSGREIALIGVDADV
                     FVTDPSVGPLLLTSILKGIDVGVHEAIVEAGNGEFDPTPFVGTLENEGVGIAPFHDWE
                     AKVPAELASKLDDLKAQIIAGDIEVESYLAQ"
     gene            292484..294004
                     /locus_tag="MTO99_01265"
     CDS             292484..294004
                     /locus_tag="MTO99_01265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="UOE44453.1"
                     /translation="MKLELRGITKKFGSLVANDHIDLTVEPGEIHALLGENGAGKSTL
                     MNVLYGLYQADEGEILLDGEVQHFTGPGDAMKAGIGMVHQHFMLIPVFTVAENVMLGH
                     ESTKAGGVLDVADARRKVREISDRFGFDVDPDALVDDLPVGVQQRVEIIKALSRDARV
                     LVFDEPTAVLTPQETDELMEIMRQLKQNGTAIVFITHKLREVREVADRITVVRLGKVV
                     GEAAPTATNAELASLMVGRAVELTVHKDAPRLGEPALLVEGLTVIDPIGQLVVNDVSF
                     QVRRGEVLCVAGVQGNGQTELTEALVGLQPRVEGRITLDGEDLTRGSVRRILNAGVGF
                     VPEDRQEDGLVGEFTIAENLMLDRADGPPFVKAGNLQLGYLAEFAEDRVEEFDVRTPS
                     IETKVGRLSGGNQQKVVLARELSRDLRLLVAAQPTRGVDVGSIEFIHKRIIETRDSGV
                     PVVVVSTELDEVTALADRIMVMYRGKVVGIVPGDTPRDVLGLMMAGESPNTEGAAA"
     gene            294043..295269
                     /locus_tag="MTO99_01270"
     CDS             294043..295269
                     /locus_tag="MTO99_01270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE46026.1"
                     /translation="MEPPSRWHQILRDITTGNAIISVLAVVLALIVGAIMIAFTDERV
                     QSTAGYFFARPGDTFAAIWDSVAGAYSAFFQGSIYNFRRPDFVSGIRPLTETLTFATP
                     LIAAGLGVGLAFRVGMFNIGGRGQMLLASAAAGWVAFSFDLPYGVHMVVALLAGLVAG
                     ALWAGIAGLLKARTGAHEVIVTIMLNYVALYLITWMLRTPGLLQAPGSNNPKTPPMKD
                     TAVFFPLLDWLSPQFNLHFGFVLAIAAVVLVWWILDRSSLGFQFRAVGENPNAARVAG
                     INVKSMYLVAMLISGALVGLAGVSQVLGTVTTGFSSGIDAGIGFDAITVALLGRSTPW
                     GILAAGILFGAFKAGGFSMQAAEGVPIDIVLVVQSLIVLFIAAPPLVRSIFRLPAPGS
                     APRRPRPIVTKEVEAK"
     gene            295266..296573
                     /locus_tag="MTO99_01275"
     CDS             295266..296573
                     /locus_tag="MTO99_01275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017888745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE44454.1"
                     /translation="MTLAPQHNAAASAPVLESTVVVSWKAPIAFAIVTLLSIALFVFA
                     PHGGEATFRLSPAGDDFQLPPVVLDSTVTALITALVMAAITVAAALLVRARRKVSIWL
                     TILFAVVFLIGFLTWAASGSSTPVIPVPGLLQGALSLSVPLIFGALCGVIGERVGVVN
                     IAIEGQLLAGAFTSAVVASVVGQAVLGQTLGLIAAAVAGVLVAFVLAAFSIKYLVDQV
                     IVGVVLNVLVLGLTSFLYTQVLAPNQATLNAPPRLERISIPVLSDIPLLGPMLFRQTI
                     IVYLMYLAVALVYVGLFHTRWGLRLRAVGEHPQAADTVGIKVNTTRFWNVSLAGAIAG
                     IGGAFFTLGAVGAFNKDMTAGAGFIALAAVIFGQWDPIKATLAALLFGFASNLQNQLS
                     VIGSPVPSEFMLMLPYVVTILAVAGFVGKVRGPAAAGKPYIKS"
     gene            296588..297019
                     /locus_tag="MTO99_01280"
     CDS             296588..297019
                     /locus_tag="MTO99_01280"
                     /EC_number="3.5.4.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013116264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004126 - cytidine deaminase activity
                     [Evidence IEA];
                     GO_process: GO:0009972 - cytidine deamination [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="UOE44455.1"
                     /translation="MPDTASIDWEHLREIAREAMAKAYVPYSEFPVGAAAIVDDGRVV
                     SGCNVENASYGVTLCAECSLVSALAMSGGGKLVAFTCVDGHGGTLMPCGRCRQLLYEH
                     SAEGMVLDTVSGFKTIDEVLPDAFGPRQLAEYAGGTTEAGA"
     gene            297016..298317
                     /locus_tag="MTO99_01285"
     CDS             297016..298317
                     /locus_tag="MTO99_01285"
                     /EC_number="2.4.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012300084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0006206 - pyrimidine nucleobase metabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidine phosphorylase"
                     /protein_id="UOE44456.1"
                     /translation="MSAVEAFDAVDLIRTKRDGGELSTAQIDWLVDAYTRGYVADEQM
                     SAMTMAIFLNGMGRREIRDLTMAMIASGERMDFSGLGKPTVDKHSTGGVGDKITLPLM
                     PLVASFGVAVPQLSGRGLGHTGGTLDKLESIPGWRADLTNDEMFAQLRDHGGVICAAG
                     AGLAPADKKLYALRDITGTVEAIPLIASSIMSKKIAEGTGALVLDVKFGSGAFLQDIE
                     RSRELARTMVELGEDAGVATSALLTNMNVPLGHAIGNANEVRESVEVLAGGGPADVRE
                     LTLALAREMLALAGLPDADVEAALDDGRAMDAWRATIRAQGGDPDAPLPVAPEQHVVT
                     ADRDGVLVRQEALPFGIAAWRLGAGRARKEDPVHHAAGIDLHAKPGDAVRAGEPLFTL
                     HADDSARFARALEAVEGAWAIGDAGDPVEDGGPLVAERIGR"
     gene            298432..299550
                     /locus_tag="MTO99_01290"
     CDS             298432..299550
                     /locus_tag="MTO99_01290"
                     /EC_number="3.5.4.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016463408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004000 - adenosine deaminase activity
                     [Evidence IEA];
                     GO_process: GO:0009168 - purine ribonucleoside
                     monophosphate biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="UOE44457.1"
                     /translation="MENPTEFRLEGDGIDLSTLPKVSLHDHLDGGLRPQTVLELADEI
                     GLEVPADDAESLAAWFAEQSDSGSLVEYLKTFDLTTAVMQTREGLTRVAREFVHDLAA
                     DGVVYGEVRWAPEQHLTGGLSLDEVVEAVQAGLDEGADEVRSQGRRIRTGQLITAMRH
                     ADRGLEIAELAVRHRDRGVVGFDIAGAEAGFLPSRHRTAFDYLASRFFPVTVHAGEAD
                     GLESIRSALIDGRALRLGHGVRLAEDLVIDRQDDEHTYVTLGPIAQWVRDREIALELS
                     PSSNLQTGAIAAWGDELIDHPFDLLYQLGFRVTVNTDNRLQSGTSLTRELALLADVFG
                     YGLDDLEVFQLNAAAAAFLPIDDRDELVEQIEDGFSEA"
     gene            299580..300062
                     /locus_tag="MTO99_01295"
     CDS             299580..300062
                     /locus_tag="MTO99_01295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010205726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="UOE44458.1"
                     /translation="MPLPPLPDEAVDISADAGDWRAAVRVAGRGLVRSGAARAEYTDR
                     MIAVIEEFGAYVVIAPGLALAHARPGADVRRAGLSVATLATPVAFGHPHNDPVRVVIG
                     LAVASADEHVTGVASLANVFNDPAAIGRLTAATSADEVRAVLGASATGDDADASEVAP
                     "
     gene            300059..300343
                     /locus_tag="MTO99_01300"
     CDS             300059..300343
                     /locus_tag="MTO99_01300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIB"
                     /protein_id="UOE44459.1"
                     /translation="MRIIAVCGAGIGTSAILKVNAERALERLGLRADVTASDLAGVRD
                     AAADAQVVLTSTELAAAVREALGRSYAEILEVTNYFDVAEISRALEKSLG"
     gene            complement(300479..302200)
                     /locus_tag="MTO99_01305"
     CDS             complement(300479..302200)
                     /locus_tag="MTO99_01305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-sugar mutase"
                     /protein_id="UOE44460.1"
                     /translation="MTRLDDDLTARAEAWLAQDPDPETRAELQGLLDAARGDDGPAAQ
                     AAAADLADRFDGRLAFGTAGLRGEIAAGPNRMNRVLVSQAAAGLAAYLLERAEPGATP
                     SVVIGYDGRKNSDVFARDSAELMAGAGVRAVLLPRLLPTPVLAFAVRHLGASAGVMVT
                     ASHNPPNDNGYKVYLGGDDHGSQIVSPADAEIAAHILRVASTTTVDALPRAPFETAGE
                     DVVDAYVTATAQVADAPPAAGAQPRVVYTAMHGVGWQTMSRVLEAAGFTAPALVDEQI
                     APDPAFPTVSFPNPEEPGAMDLSFARAREVGADLVIANDPDADRLAIAIPDPSAPEGF
                     RRLTGNEVGLILGWQAAERATASARGEGGAEGTLACSIVSSPGLEAIARAYDLEFRGT
                     LTGFKWISRAPGLVFGYEEALGYLVNPGTLRDKDGISAGLAFLSLAARLKAEGRSVAD
                     HLDTFIERFGCFASGQISIRVTDLTKIAEVMARLRATPPAEIGGVRVERIDDLAHGYG
                     DLPPSDVLRIVLDGGARVMVRPSGTEPKLKVYLDTVSTAGTVAERRAAAHAALAALDA
                     GMRALVA"
     gene            complement(302244..303071)
                     /locus_tag="MTO99_01310"
     CDS             complement(302244..303071)
                     /locus_tag="MTO99_01310"
                     /EC_number="2.4.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012298043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004731 - purine-nucleoside phosphorylase
                     activity [Evidence IEA];
                     GO_process: GO:0009116 - nucleoside metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="purine-nucleoside phosphorylase"
                     /protein_id="UOE44461.1"
                     /translation="MPQLNPLDDPAADPFEVARDAAARIAELTGVEHHDLALTLGSGW
                     GRAAELIGETTHTIPATEVPGFSKPALEGHVGTLRSVLLPNGKRALVIGARTHYYEGH
                     GVRRVVHSVRTAAATGASVMILTNGAGGIKPHWKPGTPVLISDHINLTADSPLEGATF
                     IDLTDLYSSRLRAIAKGLAPELDEGVYVQFRGPHYETPAEVRMAKTIGGHIVGMSTAL
                     EAIAARQAGMEVLGFSLITNLAAGIQTTPLSHEEVIEAGRAAEPVISRLLADVVAAI"
     gene            303216..304646
                     /locus_tag="MTO99_01315"
     CDS             303216..304646
                     /locus_tag="MTO99_01315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009774068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     GO_process: GO:0045454 - cell redox homeostasis [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-quinone dehydrogenase"
                     /protein_id="UOE44462.1"
                     /translation="MAYEFERTQRIAVLGGGPGGYEAALAGAQLGAEVTLIERAGVGG
                     SAVLTDVVPSKSLIATAEASNAVKEAADLGVQFYAKGDHEKAVKPKVAINLAAVNKRL
                     LGLAAQQSDDMRHNLIDAGVHLVQGEGRLDGPNAVIVSTAKGGTDFDRIEADTLVISV
                     GASPRILPTAVPDGERILTWTQLYHLQQVPEHLIVVGSGVTGAEFASAYRALGAKVTL
                     ISSRDQVLPGEDQDAASVIEKVFTRNGMKVLNRSRAESVVRDGDEVVATLTDGREVRG
                     SHCLMAVGSVPNTADIGLEQAGVQLAESGHIRVNRVARTSIPNIYAAGDCTTFLPLAS
                     VASMQGRTAVFHAMGDIVNPPENRNITSNIFTQPEIATIGWTQKEIEDGVVPGVVYKL
                     PLSSNPRAKMMGIREGFVKLFASNGSGAIIGGVIVAPKASELVFPLALAVEHRLTVDQ
                     FAEAFPVYPSLSGSLTDAARAMHVVR"
     gene            304718..306223
                     /locus_tag="MTO99_01320"
     CDS             304718..306223
                     /locus_tag="MTO99_01320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015491219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0016020 - membrane [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="UOE44463.1"
                     /translation="MNLRVKSVEASIADAADEERNLKRSLGTWDLALMGIAVAVGAGI
                     FSVGAQAAANFAGPSVILSFILAAVTCGLAIMCYAEFASTVPVAGSAYTFTYATMGEL
                     LAWIIGWDLILELFTAAAVLAKYWGVYLSEALLAFDVPLPATFEVGGVSISWPAFLIV
                     AIFTVLLVAGTKLTARVGAVFTLIKVGIVLFVIVVGFFFVKAANFTPFIPEAVPTEGG
                     ASDAWTQSLFAWMTGAAPAQYGVFGMLAAASLVFFAFIGFDVVATSAEEVRDPQKRLP
                     RGIFLGLGIVTLLYVLVSIVMTGMVSYRDLAAEESPSLATAFRLLDQDWASAVISFGA
                     LAGLTTVIMVILLGLARIVFALSRDGLLPRWLSKTTAHTKTPARVQIIAGALVAVVAA
                     FTDVGLLEEMINIGTLSAFVLVSLGIIVLRRTRPDLPRGFRVPWSPFLPILSAVLCVW
                     LMLNLTTLTWVRFAVWLVIGMAIYLLYGRRRSRLAGEQVSEVELPTAQGAE"
     gene            306309..307472
                     /locus_tag="MTO99_01325"
     CDS             306309..307472
                     /locus_tag="MTO99_01325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012397230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
                     /protein_id="UOE44464.1"
                     /translation="MTVTEPIVHTGGQPRPGGQPELQRIILDWFIPLTGDSRTDLSQG
                     SAMTYSGQSAASPTRAPDIGYLAQIARAVEHLGYHAVLIPTGGRSEESWTVTSALTQH
                     TRELDFLVAFRPGLVSPTLQAEIAATFQRVSGDRLRVNVVVGGDDAEQRSYGDRIGKD
                     DRYRRAAEYLSIVRRLWSGARVDHAGEFYTIEGAQLPRLDRVPEIYLGGSSEAAIEVA
                     AEHADVYLSWGEPPAQAGAKIDRVRARAAELGRTLRYGVRLHVIARPTSEEAWRIADE
                     LVAGLDPEVVAAARASFLASASVGQRRQAELVGGGLRREDLEIVPGLWAGVGLVRGGA
                     GTALVGSFEEVARLIREYRAAGFVEFVLSGYPHLEEAYWFAEGVAPLLELEPR"
     gene            complement(307544..309319)
                     /locus_tag="MTO99_01330"
     CDS             complement(307544..309319)
                     /locus_tag="MTO99_01330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009772889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-grasp domain-containing protein"
                     /protein_id="UOE44465.1"
                     /translation="MPRITKVLIANRGEIAVRVIRAARDAGISSVAVYADQDRDARHA
                     KLADEAYALDGSTSAETYLVIDKLLSVARRSGADAVHPGYGFLAENADFARAIIDAGL
                     IWIGPSPEAIERLGDKVSARHVAEKVGAPLAPGTLNPVADASEVLEFVDEHGLPVAIK
                     AAFGGGGRGLKVARTRDEVAELFDSATREAVAAFGRGECFVEKYLDKPRHVETQCLAD
                     AHGNVVVVSTRDCSLQRRHQKLVEEAPAPFLTDAQRDALYTSSKAILREVGYVGAGTC
                     EFLIGQDGTVSFLEVNTRLQVEHPVSEEVTGLDLVREQFRLAEGGVLDYPDPVVSGHS
                     FEFRINGEDPGRNFLPSPGPVHVLRFPGGPGVRVDSGVTTGDEISGAFDSLLAKLIVT
                     GSSRQDALARARRALDEFEVAGLPTVLPFHRDVVNQPAFAPEGDEPFSVHTRWIETEY
                     DNTIEPWTGELEETKGPQARESVVVEVAGKRIEVSLPKKLSGGPRPVTLGTAPRRRAA
                     SHAVDTATGDAVTAPMQATVVKVAVAEGDKVVKGDLILVLEAMKMEQPITAHKDGVVG
                     TINAETGLTVSSGHLLLSIADAPAA"
     gene            complement(309425..310066)
                     /locus_tag="MTO99_01335"
     CDS             complement(309425..310066)
                     /locus_tag="MTO99_01335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019619774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0030428 - cell septum [Evidence IEA];
                     GO_process: GO:0000917 - division septum assembly
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="Maf family nucleotide pyrophosphatase"
                     /protein_id="UOE44466.1"
                     /translation="MRLYLASTSPARLQLLRQAGIEPVTVSPGVDEEALVAEHEAEHG
                     PLDAPALVQLLARAKAEAILGSRPGGEPIDGFVLGGDSAFLVDGALHGKPHRPEVARE
                     RWAAQHGRTGLLWSGHWLIDHRGGRPGAAIGRPDAASVTFAELDDTEIDAYIATGEPL
                     AVAGAFTIDSLGGPFIRRVDGDPSTVVGLSLSTLRELVRELGGTWTSLWNRVG"
     gene            310271..311608
                     /locus_tag="MTO99_01340"
     CDS             310271..311608
                     /locus_tag="MTO99_01340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAM domain-containing protein"
                     /protein_id="UOE44467.1"
                     /translation="MARPSRHRTSSPTGAKRTAHPRRRTPAAPVAGPELELDVERIAH
                     GGVAVARHEGRVVFVADAIPGERVRAQVTDASRDRFWRAETLEVLDASPDRREHVWAE
                     ASVDRAPEQRAGGAEFGHIRMHRQRALKAEVLQDALARMAGEQREVVVVAVDDALAPG
                     VDVEAGTGWRTRVRLHVDDEGRVGPYAARSHRVVPVASLPLAATALQGIAPLGTRFDG
                     AVESVELVAPTGGGASVVVRRAGDPREAAPEIVELVGDRRFRLARDGFWQVHRGAAAT
                     LTRAVQQAIDPDRFDLAAEHLDLYGGVGLLAAAVGDRFGSTLRITSVEADARATEHAG
                     ANLADFVGARAVTARVDRFLTELGRSDASRSIRGGTIVLDPPRSGAGRDVVAGVAALH
                     PAQVVYVACDPVALARDVATFRDLGYGLEELRAFDLFPNTHHVEAVARLSAIV"
     gene            311629..312309
                     /locus_tag="MTO99_01345"
     CDS             311629..312309
                     /locus_tag="MTO99_01345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017202510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="UOE44468.1"
                     /translation="MGQAQHDGPTTVAIVDDHEAVRLGLRAACRDAGYEVVTEAAGVP
                     ELLDALGLDRVDVVVLDLSLGDGRSVTDNVRAVLATGSGVLVHSIADRVAAVREALAA
                     GAAGVIPKSSPMSAVIGAIAVVARGDVLNNVEWASAIEADRDFAKAALGRRERDVLHL
                     YASGLPLKLVAQQLGIAHSTAREYLDRIRQKYIEVGRPAPTKVDLLRRAVEDGILPGL
                     DEAGDARR"
     gene            312296..313525
                     /locus_tag="MTO99_01350"
     CDS             312296..313525
                     /locus_tag="MTO99_01350"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="UOE44469.1"
                     /translation="MPGADGRLARPADARRAVSGARVETITGRALGAAAIVFSLQTVP
                     AVIAQAEALVQGAAAALGAVMYGAAVALAVAMIARIAERITAVVYAVAYAAALVAWPF
                     LVEHPVALDGQAPWLYYLMTVATTAVVFAMPIGAAVGYTIVAPVLYGVVRLQPQGGSA
                     DPFTAAFETGYSIVLGMVVLVIVAMLRHAAAGVDAAQEAALARYDIAARQHANEIERV
                     RTDALVHDSVLTTLLAAAAAGTSDEQQLAARMARDAVARLREAGTSAAEPDASIELNV
                     LVRRLRAALTTFATPFTVRVVNAGGVELTVEAVEALYSAAVQAMVNSLQHADDGTRPT
                     RRELRIRGVRATGCVIEIADTGIGFDPAMVPTERLGLRVSIEERLAGAGGRATIASRP
                     GHGTTVTLVWPEGVDRA"
     gene            313522..314535
                     /locus_tag="MTO99_01355"
     CDS             313522..314535
                     /locus_tag="MTO99_01355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44470.1"
                     /translation="MIAISRWLLLALGAAFSMFHVVLGLSSLGVPHRPWPTLAALGLY
                     AAATVLSLWPTGRVRMPDWLAAFDLVVAIAVPVLVTTQLDPDADNGFATWYVAAVGTL
                     MTIVAARRQLVMAWIGVGALALQTLLWAGFAALGSLGVVGSIVWVAIAHALTVALASA
                     ARAARRYGQAEREAAAWQAAQDAHLFEGRMRLAQTSRIASPMLRRIADQGGVLTEQQR
                     RECRMLEAAIRDEIRGRMLLTDVVRVEVQRARERGITVTLLDEGGIDELDEPARDRVL
                     SRLAEAIARSTADRIIVRTAAEGSPVAVTVVGLRGSGDPAAHDDDDAEVELWLEIPRA
                     VDD"
     gene            314729..315796
                     /locus_tag="MTO99_01360"
     CDS             314729..315796
                     /locus_tag="MTO99_01360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013348199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004803 - transposase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1249 family transposase"
                     /protein_id="UOE46027.1"
                     /translation="MVCGSLLVKNGTTAAGTQRWRCRDCGASSVRRRPDVTRREQLRR
                     FLTWLTGKASQAELGGGTGRSFRHDTAWCWDLQPRMPITGEVHDAVLVDGVWVGSWCL
                     LIAQSSTGTVIAWQWAASESTAAWEALFTQIPPPTVVVTDGGSGIRSALARTWPDTKV
                     QRCIFHLQMNVTRELTRKPRLHAGKALRQIALALTDVHTVDDAITWRLTLEAWWQKYG
                     HLTRERSMYDNGQFGYTHHRLRKAWVILHRAAQAGHIFTNLEHGNPRATSRLEGLNSQ
                     IRNLLRHHRGMPIEHRRRAAEWFLLLHEIPIDQAHKHAHQPAPKHVEPPTEDPIGPAL
                     YDTALSAEEGLWTRSGWAGRT"
     gene            complement(316064..316285)
                     /locus_tag="MTO99_01365"
     CDS             complement(316064..316285)
                     /locus_tag="MTO99_01365"
                     /inference="COORDINATES: protein motif:HMM:NF025192.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44471.1"
                     /translation="MTEDEPTVDLRIRTRGVSDDEAAAATAVVLAAIAAQRDQPPAPT
                     GPTDGWVRAARPHRRPFERGPGRWVGWGR"
     gene            complement(316282..317883)
                     /locus_tag="MTO99_01370"
     CDS             complement(316282..317883)
                     /locus_tag="MTO99_01370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010203488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA carboxylase subunit beta"
                     /protein_id="UOE44472.1"
                     /translation="MTEATTDGPDLTTTAGKLADLKHRYHHAVTAAGEAAQVKQHAKG
                     KLTARERIEGLLDPGSFVELDEFVRHRTHAFGMEEKRPYGDSVVTGTGTIHGRQVAVY
                     SQDFTTFGGSLGEVAGEKIIKVMDLALKTGVPIIGILDSGGARIQEGVVALGKYGEIF
                     RRNTQASGVIPQISIVMGPAAGGAVYSPALTDFVIMVDKSSHMFVTGPDVIKTVTGEE
                     VGFEELGGALTHNTVSGVAHYLASDEDDALDYARTLVSFLPDNNMSESPVYDADVELE
                     ITDADHRLNTVIPDSPNQPYDMHQVIAGVVDHGDFLEVQPLFAPNILIGFARIEGRSV
                     GIIANQPNQMAGTLNIAAGEKAARFVRFCDAFGLPIVTLVDVPGYLPGTDQEWTGVIR
                     RGAKLLYAYAEATVPLVTVITRKAYGGAYIVMGSKQLGADINLAWPTAEIAVMGGQGA
                     VNILYRAELKRAEEAGEDVAAVRTQLANEYTYNVASPFLAAERGELDGVIEPAATRVA
                     IVKALRTLRTKRASLPPKKHGNIPL"
     gene            317986..318972
                     /locus_tag="MTO99_01375"
     CDS             317986..318972
                     /locus_tag="MTO99_01375"
                     /inference="COORDINATES: protein motif:HMM:NF015084.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--[acetyl-CoA-carboxylase] ligase"
                     /protein_id="UOE44473.1"
                     /translation="MEWGRSRAQVGRFEFLEQATSTNDVLREAATGPEAVDWPHGAVV
                     VTDDQTAGRGRLGRTWLAPTGKTLAISVLLRPARRDGRPLDAASLGWLPLIAGLAMTE
                     AVERAVGRAGLAEPSGLTEPSGLAEPVGLAEPVGLAEPVEAKHPSTGSGSFPSTGSGS
                     TASTVEDDGPGLVEVELKWPNDVLISGYKVCGILTELLPGGDAVVVGAGLNLTLDEHD
                     LPTLTSTSLLLATGRRPDADAVLADYLGTLLAAVDEFLAADGDATASGLADRIAQRCG
                     TIGADVRVELPGGGELLGTAERLDRDGRLVVRDRESGEPQAVGAGDVTHLRY"
     gene            318980..319552
                     /locus_tag="MTO99_01380"
     CDS             318980..319552
                     /locus_tag="MTO99_01380"
                     /inference="COORDINATES: protein motif:HMM:NF015648.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PH domain-containing protein"
                     /protein_id="UOE44474.1"
                     /translation="MSRPPSTSRTGAPTASPERVVARVRRHGRMLILPVLLLVAVAGA
                     LPYALGILAEDWQRWAAIALAAVLVVLGVLLPYLAWLTRRTTITTRRVILRSGVFVRT
                     RRDVPLARSIDIRVRQSPGQRLFGCGDVRVDAGQERPVVLQDVPRPALLQEALHELVD
                     AEHARAVLAAQAAGRPGGGIEGDTVVFGAR"
     gene            319685..320560
                     /locus_tag="MTO99_01385"
     CDS             319685..320560
                     /locus_tag="MTO99_01385"
                     /inference="COORDINATES: protein motif:HMM:NF025840.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4433 domain-containing protein"
                     /protein_id="UOE44475.1"
                     /translation="MAECIHGFDDGLCAICFPPKQPEPPEIPTRAASARATTTRGSTT
                     RSTAPRTRGARAAAGRTAVPGRRAGELTTPIDVRALRVYHVTHIDNLAGILGAGAVLP
                     DVGDPAATPAVDLAAPAARDFRRSAHVPGTDTAIAEYVPLLLSTNADVWDAVRSGRPD
                     PRLTAEAVERPAAEHVVFVGSVASTLGPREAQPDAVAAGASDAAIAGDEFEVGWDAVE
                     RMLRRLARLEESAPFDRAELLVRGPVPLERFSLIAVANDRVRDRVRQALSAVGAKAKV
                     AVYPPWFQPGGGAEA"
     gene            complement(320518..321126)
                     /locus_tag="MTO99_01390"
     CDS             complement(320518..321126)
                     /locus_tag="MTO99_01390"
                     /inference="COORDINATES: protein motif:HMM:NF016060.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GtrA family protein"
                     /protein_id="UOE44476.1"
                     /translation="MTTPATPLRRLWHGLVAYLLKFGVVGLIGLVIDVALFNALRLGA
                     FGADGWAQSAIGAKTVSTSAAIVFNWVGNRYWTFRRHRRRNYLREFAEYLLVSLGGMA
                     ISLGCLWISHHALGFTSLLADNIASNVIGLGLGTAFRFLLYRYWVWGAYRADGLSAAA
                     RVEEAQRALFEEPPAGADDANAGEPDAPAQASAPPPGWNQGG"
     gene            321245..322336
                     /locus_tag="MTO99_01395"
     CDS             321245..322336
                     /locus_tag="MTO99_01395"
                     /EC_number="6.3.4.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019619766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004638 - phosphoribosylaminoimidazole
                     carboxylase activity [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0046872 - metal ion binding [Evidence
                     IEA];
                     GO_process: GO:0006189 - 'de novo' IMP biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide
                     synthase"
                     /protein_id="UOE46028.1"
                     /translation="MMVPAAIELGVELRVLAEADGMSAAIAADRVGDYTDTATVLDFA
                     KTVDVVTFDHEHVPQDVLRALVDAGVAVRPGPDALRYAQDKLLMRERLSELGLPVPDW
                     ARVVAPAELDAFIAEHGGAAVVKTPRGGYDGKGVRVVRSAAEVSEWFTAAAEDGGQGA
                     LLVEELVDFRRELAQLVARRPSGEVAAWPLVETVQVGGVCSEVIAPAPKSAGRLADVA
                     ADVAVAIADGLGVTGVLAVELFETVDDRVLVNELALRPHNSGHWSMDGATTGQFEQHL
                     RAVLDLPLGGTGTHRPWSVMVNILGGPEEGQLVDRYAEAMANHPTAKVHNYGKQPRPG
                     RKVGHVTAVGDDLDDVVYEARSAAAVFQD"
     gene            322531..322998
                     /gene="purE"
                     /locus_tag="MTO99_01400"
     CDS             322531..322998
                     /gene="purE"
                     /locus_tag="MTO99_01400"
                     /EC_number="4.1.1.21"
                     /EC_number="5.4.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010156096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0009320 - phosphoribosylaminoimidazole
                     carboxylase complex [Evidence IEA];
                     GO_function: GO:0004638 - phosphoribosylaminoimidazole
                     carboxylase activity [Evidence IEA];
                     GO_process: GO:0009152 - purine ribonucleotide
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide mutase"
                     /protein_id="UOE46029.1"
                     /translation="MGSDSDWSVMQEASAVLHEFGVTHEVEVVSAHRTPEKMIAYGQQ
                     AAGRGLRAIIAGAGGAAHLPGMLASVTTLPVIGVPVPLARLDGLDSLLSIVQMPAGIP
                     VATVSIGGARNAGLLAVRILGASDPALTAALERHATALAELVEEKNERLKQSR"
     gene            322995..324368
                     /locus_tag="MTO99_01405"
     CDS             322995..324368
                     /locus_tag="MTO99_01405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017884393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LCP family protein"
                     /protein_id="UOE44477.1"
                     /translation="MSLAASPIRFPDASSRTVMTRRGWWLVLLNVLVPGSAQVLAGNR
                     RLGRFGLGATLTLWFLAVAALVVWLVWPTVLYTVVTSTIGLWAIALVALFYAVLWVVL
                     TFDTLRLVRLVKTAPGARFGIAALGVVLLVGVSGTAAFGAYVATTTSGFLSDVFVAGP
                     PVPPDENGRYNFLLLGGDAGPDREGLRPDSIRVVSVDAETGQAVTVGLPRNMEDVPFG
                     EDSPLHAVYPEGYGAIDGCEVDACMLNSIYTEVELKSPEMYPDAVAQGSEPGIEAMRD
                     AAEAITGLDIQYYVLIDMAGFQQLVDALGGVTVNVPEDVPIHADETFTTVAEWIPAGE
                     QHLDGYHALWYARSRHGTSDYDRMARQLQIQEAMLAQFNPANVLSKFQEIAAAGSQVV
                     KTDVPQSMLGYFVNLATKAKELTTPVVDIPLVPDNGFDPEDPDYAYALQLVQQAVVPP
                     ATEEPAE"
     gene            complement(324682..325821)
                     /locus_tag="MTO99_01410"
     CDS             complement(324682..325821)
                     /locus_tag="MTO99_01410"
                     /EC_number="2.4.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="UOE44478.1"
                     /translation="MTTTLRFIVDQVVAPVPGPLGRYTVDLGRALVESAPAGTAVEGI
                     VSSSPESDYERVRHEVPGLSDLYKTSLARRELLAAWQLGLTTSPGGGIIHAPSLFAPL
                     RRHQREHGDQVVVTVHDVLAWTHPEAVSATSVAWQKAMLKRARKHADAVVVPTHALAD
                     QLSMVADFGDRVRVIGTAPRTGLRVDTDAAERAARLGLPQGGHLVVAGTLEPRTGLVD
                     VLAALGRPGVPDVPLVVIGPGNWGEQHLATVAEEYGVAPTRVRHFEELDAADLAVVLH
                     GATAFVAPAHDAGAGTTLIEAFSLGTPVIHSDIPAYAETAAGAGLAVPVGVGDGFADR
                     LAAAVTRVVEDREFAARLAIAGSDRSRAFSWRDSAERVWQLHADL"
     gene            complement(325913..326767)
                     /gene="rfbD"
                     /locus_tag="MTO99_01415"
     CDS             complement(325913..326767)
                     /gene="rfbD"
                     /locus_tag="MTO99_01415"
                     /EC_number="1.1.1.133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008831 - dTDP-4-dehydrorhamnose reductase
                     activity [Evidence IEA];
                     GO_process: GO:0009243 - O antigen biosynthetic process
                     [Evidence IEA];
                     GO_process: GO:0019305 - dTDP-rhamnose biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="UOE44479.1"
                     /translation="MRWLITGASGMLGRDLQAALAGQDVTALGRAELDVTDAAAVRAA
                     VAGHDVIVNCAAYTKVDDAETHEAEAYAVNATGTGLLAAAAAEAGAKFVTVSTDYVFD
                     GHATEPYAEDRPRDPINAYGRTKAAGEELALAAHPDGAYVVRTAWLYGEHGPNFAATM
                     LKLAATKDSWSVVDDQVGQPTWTADLAAQIIALVDADAPAGVYHGTNGGQTSWFGFAR
                     AVLEAAGLDPERITPTDSSSFVRPAPRPAYSVLGHDAWASAGLAPMRDWRDALHAAAT
                     AGVFPLLG"
     gene            complement(326771..327769)
                     /gene="rfbB"
                     /locus_tag="MTO99_01420"
     CDS             complement(326771..327769)
                     /gene="rfbB"
                     /locus_tag="MTO99_01420"
                     /EC_number="4.2.1.46"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018768482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008460 - dTDP-glucose 4,6-dehydratase
                     activity [Evidence IEA];
                     GO_process: GO:0009243 - O antigen biosynthetic process
                     [Evidence IEA];
                     GO_process: GO:0019305 - dTDP-rhamnose biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="UOE44480.1"
                     /translation="MSNLLVTGGAGFIGSNFVHYVIDHTDHTVTVLDKLTYAGNLASL
                     EGLPEDRFRFVKGDIADAPLVDRLVAEADAVVHYAAESHNDNSLADPRPFLDTNIIGT
                     YTLIEAARRHGTRFHHISTDEVYGDLELDDPARFTEQTPYNPSSPYSSTKAGSDLLVR
                     AWVRSFGLQATISNCSNNYGPYQHVEKFIPRQITNVLRGERPKLYGTGENVRDWIHAN
                     DHSSAVLTILEKGRIGETYLIGADGEKNNKDVVELILTELGQPADAYDHVNDRPGHDL
                     RYAIDSSKLRTELGWTPQYADFAAGLADTIAWYRDNEGWWAPQKDATEARYKAQGQ"
     gene            327872..328480
                     /locus_tag="MTO99_01425"
     CDS             327872..328480
                     /locus_tag="MTO99_01425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="UOE44481.1"
                     /translation="MQIRELKVPDSYEVTPKQFGDDRGVFLEWYRFDRLEETIGHPLK
                     LAQANTSASKRGVVRGIHFADVPPSQAKYVTATHGAVLDFVIDIRTGSPTFGQWDSVL
                     LDDIDRRAIYIAEGLGHCFVALTDDATVSYLVTSTFNAEREHGVNPLDPAVGLDFGIA
                     ADDLLLSPKDTEAPSLAEAEASGLLPTWEQARAYYDELNKGA"
     gene            328480..329343
                     /gene="rfbA"
                     /locus_tag="MTO99_01430"
     CDS             328480..329343
                     /gene="rfbA"
                     /locus_tag="MTO99_01430"
                     /EC_number="2.7.7.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008879 - glucose-1-phosphate
                     thymidylyltransferase activity [Evidence IEA];
                     GO_process: GO:0009243 - O antigen biosynthetic process
                     [Evidence IEA];
                     GO_process: GO:0019305 - dTDP-rhamnose biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase RfbA"
                     /protein_id="UOE44482.1"
                     /translation="MRGIILAGGSGTRLWPITKGISKQLMPIYDKPMVYYPLSTLMMA
                     GINEILVITTPEYHVQFKALLGDGSQLGIRLEYAVQPSPDGLAQAFIIGEEFIGDESV
                     ALVLGDNIFHGTGLGSALRTHNDIDGALIFAYQVSDPSAYGVVEFDEQFRALSIEEKP
                     AAPRSNYAVPGLYFYDNSVVEIAKTIEPSARGELEISTVNERYLQAGKLQVQVLDRGT
                     AWLDTGTFESMMQASEYVRVIEDRQGFKIGCIEEIAWRAGWIDDAALAVLADQYRKSG
                     YGTYLSRLLAG"
     gene            complement(329383..330249)
                     /locus_tag="MTO99_01435"
     CDS             complement(329383..330249)
                     /locus_tag="MTO99_01435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017888786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="UOE44483.1"
                     /translation="MPASAESRVAVVTVSYNSSAQLAAFLTSVGRQTPAPARVVIVDN
                     DSADLDETRTVAAEFGAHVVALEHNVGYGGAINAGVLALGPEIDYVLISNPDIALHDG
                     AIAILTEAGERDQGVGAVGPRILNEDGTTYPSARSIPSVRTGVGHAVLGHPWPANPWT
                     RAYRGEHADTGAARDAGWLSGSCVLVRRSAFDAIGGFDESYFMYFEDVDLGYRLGKAG
                     WRNRYEPSASATHIGGVSTRTESARMLRAHHESAIRFINRKYAAAWLAPLRWTLTLGL
                     RTRLRLMSRRAR"
     gene            330383..331669
                     /locus_tag="MTO99_01440"
     CDS             330383..331669
                     /locus_tag="MTO99_01440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 1 protein"
                     /protein_id="UOE44484.1"
                     /translation="MVGSIGRLVSKAVSGGPRLIVRKVRTAAALVRTQGAGAAYRYAR
                     TKLARAAGPQVPTLLVALEDAAAVDWTTIPDRISESITVESGSARIAWIMSPPGRESG
                     GHQNLFRFIEFAERAGHDCRIYLYQADDRPVDVAGVRAMLAASEAYPTLRAPIEVWNR
                     ERGVADDTQAIFATGWETAYPSFLDRSHAKRLYFVQDFEPSFYPVGSESILAENTYRF
                     GFHAITAGGWLAHKLRDEYGMAADHFDFAVDTERYRITNDGPRNEIFFYARPVTPRRG
                     FELGLLVLNDFAKLRPDVTINLAGWDVSNWRIPFAHRNLASLQLSELNEVYNRCAAGL
                     VMSLSNMSLLPLELMSSGVTPVVNDGPNNRMVSDNPYIEYVPSSPLAIARKLVEVVER
                     PDAVERSRAMSESVRGVDWAASGDVFVKALEGALRG"
     gene            331662..332591
                     /locus_tag="MTO99_01445"
     CDS             331662..332591
                     /locus_tag="MTO99_01445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006681344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="UOE44485.1"
                     /translation="MARAVVIGANGFIGSHLVDGLVREGHDVRAFDRFSSRRATFTSD
                     SVEVVTGEFLSRADLEAAVEGQEYVFHFLSTTTPATAEADPTLDIRTNVAQTVELLES
                     CAAAGVEHLYFASTGGAIYGDQGLAEYSESDRALPISPYAIGKLTIEHFLHYFQATHG
                     LRSTVLRVSNPFGTRQKPNSKQGLIPIALRQIALGRPVVRFGDGSMVRDYVYVEDLVK
                     MVLAITGHETAHDLYNLGSGVGYSVNDVFDSIRRVTGEEFEIVERPVPPTFVDRVILN
                     TDRYRDEFGEHSLTSLDDGIRLTFDEIREHTDV"
     gene            332584..333555
                     /locus_tag="MTO99_01450"
     CDS             332584..333555
                     /locus_tag="MTO99_01450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="UOE44486.1"
                     /translation="MSDPIATVTILTYNGEEYLERILAQLRAQELDAPFEVLVIDSGS
                     TDSTLDIVRRFPEVRLHEIPNSEFGHGRTRNLAARLANGEFVAYLTHDAIPIGPNWLR
                     ELLAPFAIDERIVAVMGKQVPRRECFPLLKYEIQGVFAGFGPDLATSVFYKDDAIDDS
                     ALGYLGFYSDVNSAARRDFLLNTIPYRDVRYAEDQLFGRDIIEAGYRKAYAPRAAVEH
                     SNDLTLDEYGKRIFDETVGLRQIGEPIPRMSRRSQIRLTARGIAGDTIRILRDRDYSW
                     RRKLYWLVVNPSFQIRKWSSYRPSTLVDLADDRAIASGSLEHSRKQA"
     gene            333709..334887
                     /locus_tag="MTO99_01455"
     CDS             333709..334887
                     /locus_tag="MTO99_01455"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44487.1"
                     /translation="MTLELAEFIASLGAEVVVATQSFGRPLRSEFEDRGLTVFEITDE
                     RLDADLAERMPDVAWIQHGVIPERVLASPGSTTFYFHHMSAHLAPEFTSIPEIESALA
                     TAVLFESPSSLDAHVATGLYEKIDPERLQVFGNPAPARFAEAVRPDQLRRSLLVVSNH
                     IPAELLEALELLSDEFDVDLVGSQRELGAAPRRVDVDDIASVGAVVTIGKTVQYSITA
                     GTPVFVYDHFGGPGWLTSENFEHTAYENFSGRRTRRLSAREIESQIRAGFDAAADEAE
                     RLRSTVAQRYSISSRFEQLLEWSRDRQVRLDSIPEGWVRAQQSIQATVGTYIREWIRE
                     QGNASYNGELAAAWEAQRQAIAAQLHAVTTSRSYLALLRLGRVKRALLAPFVRMSRRR
                     "
     gene            complement(334928..335413)
                     /locus_tag="MTO99_01460"
     CDS             complement(334928..335413)
                     /locus_tag="MTO99_01460"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44488.1"
                     /translation="MFYADADERFVGDIRGTLRSPRFADVQGVRIELFDAYMTADDHE
                     PYVSGRPLLDFREYFGVERRRILMAWRPSAGVDYRLPDSREPQGIHGRIEVDFRCQHY
                     GKALSIEQWDETCRYYIDNFPPVYQERWRARLGKAIHARSDFDTELRRWDDVLQHAED
                     I"
     gene            335519..335920
                     /locus_tag="MTO99_01465"
     CDS             335519..335920
                     /locus_tag="MTO99_01465"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44489.1"
                     /translation="MHLRMPARDLDGGIRARIVEHDDRIGETSQMIERVREQELLVPN
                     SDHRHDPRPCRYPVKPAANDSVGRRQVAQDDVTEEGQAFSNRRRGPRQPGRAPGCGQE
                     VPADGPDVESPDAGAHCASGLSEFLYAVIVE"
     gene            complement(335869..336582)
                     /locus_tag="MTO99_01470"
     CDS             complement(335869..336582)
                     /locus_tag="MTO99_01470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_023325616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="UOE44490.1"
                     /translation="MSKRFRLYHERNQSLKSAVMRRRISVHEDFWALRDVSLEVPMGS
                     TFGLIGSNGSGKSTLLKCLARILYPEQGAITANGKVAALLEVGSGFHPELSGRENVFL
                     NGSILGMSRKEISRKFDEIVAFSGVEQFIDQPVKNYSSGMYVRLGFSVAINVDPDILV
                     VDEVLAVGDAEFQAKCHQKFDDFKRDGKTVILVSHSLSTVESMCDHAAWLNKGTLMTS
                     GDAHSTITAYKNSLSPEAQ"
     gene            complement(336609..337445)
                     /locus_tag="MTO99_01475"
     CDS             complement(336609..337445)
                     /locus_tag="MTO99_01475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013771669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE44491.1"
                     /translation="MGYLKELASSRELLSNLVLRDIRGQYKRTVLGRLWSLASPLTAM
                     LVYTFVFSFVFRIQPAAGDPSGLNVFALWLLCGLLPWTFFSSAVSTGMASLVGNAGLI
                     TKVYFPRIVLPTAAVLTVGYNWLFEMLVLSVALLIAGSFLWPWIPLVILMMVVLAVFA
                     TGVALALSVANVYFRDTQYLLTLVLQVWMYLTPIVYPISLVADQSDRLGGLFGTSVTV
                     LDIYSLNPMLHFVTVFRYLMYDNRLPELSDVLACVVWALVSLVGGFLIFRKNEKGLAE
                     TL"
     gene            337535..339877
                     /locus_tag="MTO99_01480"
     CDS             337535..339877
                     /locus_tag="MTO99_01480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012037708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44492.1"
                     /translation="MPQPEPCYIHRQGEAVRAMTRGLREGDSVADATTFGGVRQRGRI
                     IGILVATLALVAGLIAIPQQSSIAANGSDFDPGFIIADDLFYDGAAMSAGQVQSFLNA
                     RVPQCRAGYVCLKAYSQDTASRAGEAGRCGGYAGAPGESAATIIAKVGAACGVSQKVL
                     LVLLEKEQSLVTDDWPTSRQYRSATGYGCPDTADCDAAYYGFFNQVWMAALQFKRYQA
                     NPGGWRHIAGRTVNVLFHPNAACGSGPVYIMNAATAGLYNYTPYQPNAAALANLYGTG
                     DGCSSYGNRNFWRIYTDWFGPTKIGPQYFIEKTYRDYGAEAGVLGPAVTDIRSFTANG
                     GGAVRGYQNGAIAWSAPRGAFAIMVAIRATYGAWGGVEGWIGWPASGANSISAHGGGT
                     VQAFQFAAIASSQTGTWPIPNANRTALAAVGGIDGEFGWPMGENVCDAQSRCIQAFQG
                     GSVYGRTGAAFGLPASIRAVFETNGGRTGAFGEPTSNPNRIEANGGGRAQGFEKGAIV
                     ESPAGTFAVTGGIRTAFNAAGGIGGVPGWPVAAAACDAGGACSQRFQHGSAFSSSDGA
                     AWFIDERLAGEYAALRATLGKPTSGTNAIAANGGGIVQGYEGGAIAWSSTGGAHAITG
                     VLRTQYNALGGIAGQPGWPTGSATCAAGVCTQRFAGGLMVSSAQRGSLVISQATDRYL
                     AAGGPTGSLGWPTTGGIRFEASGGGFVQAFEQGAIAASASGAYVVSGGVRAFYNERGG
                     ITGPLGWPASEMTCDSAGTCSQQFQNGRIVWSPIGGGRVE"
     gene            complement(339890..340675)
                     /locus_tag="MTO99_01485"
     CDS             complement(339890..340675)
                     /locus_tag="MTO99_01485"
                     /EC_number="2.4.-.-"
                     /inference="COORDINATES: protein motif:HMM:NF025025.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="UOE44493.1"
                     /translation="MTEVSVIIPTNRIDRWLDDAIESVLASRGVEVVLVVVLDGIPVD
                     ESRPWADDPRVEIVPLPENVGQTVAMNTGVRASRTSYVARLDSDDLVDPDRLALQADH
                     LDRHPDSPAVGSAVIRIDEHSRVTGEVALPTGDDIRPTLLLSNTVAHSSLLFRRSAFD
                     AVGGYDERLRQMEDYDFILRIARSGPIANLPRPLIRYRVHSGQTSRGATPRGRHIDAV
                     SRGRLELARSIGASPVLTRVKLSAWRALQFLRYHRLVRPGHER"
     gene            340727..341956
                     /locus_tag="MTO99_01490"
     CDS             340727..341956
                     /locus_tag="MTO99_01490"
                     /inference="COORDINATES: protein motif:HMM:NF024831.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="UOE44494.1"
                     /translation="MTSVAEARAPRRRMHCAAATRLRGEAVRLPEHVLFVVSNYPPHL
                     GGVEFHVQRLAVELVASGHRVTVLTTTTGADVGVSEERGVAVIRIPGRVPVQDILSFP
                     APGTARRIRSLCRQRDVTVVSTHTRFFPMSFVGARAAARAGIAHVHTEHGSDHVRGVG
                     PIVGLTSRLVDRTIGRRVLRSADAVLAVSDRVQTFVRRLSGREAIVFPNAIDIGPWLA
                     ARPSRPRERRRLVFLGRLVPGKGWDDFITTAALLRDRGFEFDAEIIGDGSDRPSVEVA
                     VKRERLDGVVAVRGRVVGADLARALAGSTLVNATRLAEGFQTSLIESVAAGGDVVTYP
                     IAGASTLAEAGAPVCIVAESTPAALATAIAEGRPGRVFDASRLAAWDWQTRARDYATL
                     LASVRAERARVHAKSRR"
     gene            342054..342698
                     /locus_tag="MTO99_01495"
     CDS             342054..342698
                     /locus_tag="MTO99_01495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010851581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="UOE44495.1"
                     /translation="MPLFNEATVVRSVVEEARRTFPNIVCIDDGSSDDSVAEAEAGGA
                     VVVKHPTNLGQGAAIRTGLDYALQDPSAEYFVTFDSDGQHQVDDVVGMIGRLKTGDSD
                     IIVGSRFLDGRTKPGFLKSIVLRLAVLFESMSTGVRLTDAHNGLRAMNRHAATVIKID
                     QNRMAHASEIVAEIGRNKLEYAEFPVHVVYTEYSRSKGQSIWNSVNILNDLFLK"
     gene            342715..343092
                     /locus_tag="MTO99_01500"
     CDS             342715..343092
                     /locus_tag="MTO99_01500"
                     /inference="COORDINATES: protein motif:HMM:NF021575.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2304 domain-containing protein"
                     /protein_id="UOE44496.1"
                     /translation="MGDQFFIKLLLIGVLAAFAAIVLIPGRGTRKLAIKRIALLMLFL
                     AAVVAVLFPQLINGLANLVGVGRGTDLLLYGLIIVFVGHTISTSLRFRQQEREITQLA
                     RSVALANASRPWEETPAEEHSDS"
     gene            complement(343146..344093)
                     /locus_tag="MTO99_01505"
     CDS             complement(343146..344093)
                     /locus_tag="MTO99_01505"
                     /inference="COORDINATES: protein motif:HMM:NF033563.0"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004803 - transposase activity [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="IS30 family transposase"
                     /protein_id="UOE44497.1"
                     /translation="MRRNLHSSGQYRPFHAHATAASRRRRTRPLKLTSDPVLRSFVVA
                     RLKERWSPQQISRALQRAHPQEPARRVATETIYQAIYRPATGIVRKPAPSPLRTGRDH
                     RRGHTRQIRAGRRFAQPMLSVWDQGTEMAKHLDVTADTGTRIYFCDAASPWQRGSNEN
                     ANGLQRQYFPKSTDLSVHSPRDLARVELELNRRPRITLGDRTPHELFNALLASENHAR
                     CDDRWNTRRRHGLLFKRRRQDAVLGAERRHRAARRVIRPLRDRQTGHGDRQAHFGSYT
                     HQSDRSVTTEKPRNRHRCPDPELSPKFWEMTPRGASREP"
     gene            complement(344153..344338)
                     /locus_tag="MTO99_01510"
     CDS             complement(344153..344338)
                     /locus_tag="MTO99_01510"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44498.1"
                     /translation="MELLAEGWSMSAAAREVGVGRSAANIWKNGTTVRRKDGTVKVVP
                     PLEPLSVRVISPRFLSD"
     gene            344493..345308
                     /locus_tag="MTO99_01515"
                     /pseudo
     CDS             344493..345308
                     /locus_tag="MTO99_01515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011691690.1"
                     /note="frameshifted; internal stop; incomplete; partial on
                     complete genome; missing C-terminus; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology.
                     GO_process: GO:0015074 - DNA integration [Evidence IEA]"
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DDE-type integrase/transposase/recombinase"
     gene            345386..345532
                     /locus_tag="MTO99_01520"
     CDS             345386..345532
                     /locus_tag="MTO99_01520"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44499.1"
                     /translation="MTVNGGIKIKGVTFQIGSHLTGTLITIIRDEARSRPDYTKPRED
                     RPRL"
     gene            complement(345690..346721)
                     /gene="gmd"
                     /locus_tag="MTO99_01525"
     CDS             complement(345690..346721)
                     /gene="gmd"
                     /locus_tag="MTO99_01525"
                     /EC_number="4.2.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012399114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008446 - GDP-mannose 4,6-dehydratase
                     activity [Evidence IEA];
                     GO_process: GO:0000271 - polysaccharide biosynthetic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-mannose 4,6-dehydratase"
                     /protein_id="UOE44500.1"
                     /translation="MSDQKPKRAFITGITGQDGSYLAELLISKGYEVHGLIRRASTFN
                     TSRIDHLFTDPHSTDAKLTLHYGDLTDGSRLVTLLSTIQPDEVYNLAAQSHVRVSFDE
                     PEFTGDTTGLGSVRLLEAVRLAEIDVRYYQASSSEMFGATPPPQNEDTPFYPRSPYGA
                     AKVYSYWITRNYREAFDMFAVNGILFNHESPRRGETFVTRKITRAAARIAAGVQSELY
                     MGNLDAIRDWGYAPEYVEAMWRMLQHDEPQDYVVATNTAYTVRDFLDFSFQRVGLDWQ
                     KYVKFDERYLRPTEVDALIGDASRAYDLLGWTPRVKTPELAQIMVDNDVKALEFGGTT
                     WVDEVAWTA"
     gene            complement(346782..347954)
                     /locus_tag="MTO99_01530"
     CDS             complement(346782..347954)
                     /locus_tag="MTO99_01530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018171938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DegT/DnrJ/EryC1/StrS family aminotransferase"
                     /protein_id="UOE44501.1"
                     /translation="MTAPRYPLATTTWDNAEYEALQSVITSGRFTMGPEVRAFEEEFA
                     AALGARRAVMVNSGSSANLIALTAAVVNPDIDLSPGDEIIVPAVSWATTFYPAHQLGL
                     RLRFVDVDLDSLNMSAATVAEAITTATKAILAVNLLGNPAELVELSKLAAERNLVLIE
                     DNCESLGANVDGRQAGTFGLAGTYSSFFSHHIATMEGGLITTDDEYTYQAMVSLRAHG
                     WTRELPNDNLIHPKTGDAFDDLFRFVLPGYNVRPLEMSGALGRQQIKKLPGLIAGRRT
                     NAKLFVERFAGRDDVRVQREHGESSWFGFSLVLEGRLAGRRADLVNALADQGIESRPI
                     VAGNFTRNPVMRYFDAEVPATLPAADKIHTDGLFLGNHHYPIERELDLLLSVIDGI"
     gene            complement(347991..348887)
                     /locus_tag="MTO99_01535"
     CDS             complement(347991..348887)
                     /locus_tag="MTO99_01535"
                     /inference="COORDINATES: protein motif:HMM:NF027681.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003824 - catalytic activity [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="UOE44502.1"
                     /translation="MLARSIAAAWRTAGRDDELIPVTRADADLRDPIAVERLFQEIAP
                     DTVIHTAARVGGIAANIADPAGFLMDNLRLDSNVLSTSVAAGIRRFVYFGSSCMYPKD
                     YRQPLVESDVLAAPLEPTNEGYAISKIAAARYCQYTAEQFGWDYRVIIPSNLYGPGDD
                     FALDRAHLVAATIAKAHEAKSTGATKIDVWGDGLARREFTYVGDLAEWLVSKLDGLSA
                     WPALMNVGKGEDFSILDYYRAALNAVGYEADLVTDPSKPAGMHQKLMDSSVASEFGWS
                     PSTDLTDGVAKTYADYLARLDH"
     gene            complement(349039..350322)
                     /locus_tag="MTO99_01540"
     CDS             complement(349039..350322)
                     /locus_tag="MTO99_01540"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44503.1"
                     /translation="MVNPSSSGRREASTPTTSDTARTVHLLAAQFLRNLGPLLILFLL
                     ARMTEPETVGTYSLALAIATPFFVFAQLGMRTVTLTLSPEASFRNYTIVQSAALAIAL
                     VAACVFGGVWAPQLEAVVLLAALVKVADAFSELSSGPLQRRGHSLTVFTASLIAAILV
                     SLAAAVVLALTRELIPTMLALATSSLLSAYLFLFRPAHRASIVAESEHPPPAAGVRRE
                     TRRIAAAGLPLGAAMSLMSLIATVPQYLVTGSFGAAETARLAILLYLFALADIVTGVL
                     SQAWIPQAQQAARRGAARASILSITARATIKWTLAYVPITLIGLLLATWLVPLVFGKA
                     YTLSLAEAIPLGLAIMALPSAHFMATAVAIQNAYVHALTLAVGSTALSLATCLVLIPQ
                     LGVAGAFWALLVSVASRAAIAATVLRLRSRRPRSV"
     gene            complement(350383..351303)
                     /locus_tag="MTO99_01545"
     CDS             complement(350383..351303)
                     /locus_tag="MTO99_01545"
                     /inference="COORDINATES: protein motif:HMM:NF013681.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-1,2-fucosyltransferase"
                     /protein_id="UOE44504.1"
                     /translation="MAAVRDISDGICAYLQGGFGNQLFILAAAWEQAERLDCPLYVDA
                     SRFIASDPIERTKETPWGFQLAGVAFDGTVLREDSPWYRNSPRRPAAIRHPGRGSTRL
                     KVYRQPTLNFHDTVNRVTPGTTLFGYFQAWRYFEGVSDQLAAALTGAKISAPESEQLA
                     RLCQAETITAHVRRGDYLTPQAARHHGIASATYFTRAISLLRQLQSDTSRVRVFSDSP
                     DLVRDELAELQELDFVEDTGILGNVATLIAMSNGVGFAMSNSSFSWWAAWLLSRRDPN
                     APVVAPRPWQADGQSGHDLLLPNWHTLDAR"
     gene            complement(351352..352785)
                     /locus_tag="MTO99_01550"
     CDS             complement(351352..352785)
                     /locus_tag="MTO99_01550"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44505.1"
                     /translation="MSNVLAEQPSTVQHRVRSWLGRFWVPLALVLVAVGYSSAVTIQH
                     SDAMSPIDEWVYLDYLDKLPTQGVLTPGEEIGPEGLDRMACDGVFPYGPMGAACGSSY
                     ADVSTFPFGGITSADPYTPFYFGVTRVVGDAIHFVSGVDQLTAWRLTGSLWLAASVLL
                     LWLLLRQWRVSSTAALGLGLAFIASPFAWWTYTYVSTDAPSFLAGAALLFVTTRFVRG
                     TGSLWWIPAIAVLATIFKVTNLLAVGLSALYLVIHGLITVWNRRKQRVSGAEGLAEFG
                     GSPAEGPAPARRLRREWLVLIVAAATSVAAILTQFVWLRIHASLRPEGAAGSSGGNPL
                     GVQELLGQMANFLPGTITSNVNIAGSTGYALPIPGFAVTPLSWLTIAGVIGAFWALRG
                     VTPRSPLVIAIAISSVVFAPALALALYVTTGSYFTLPPRYGASILAGFLLAAGLVIRN
                     RWASWILVGYGVALLGAMSVLTALLHD"
     gene            352874..353830
                     /gene="galE"
                     /locus_tag="MTO99_01555"
     CDS             352874..353830
                     /gene="galE"
                     /locus_tag="MTO99_01555"
                     /EC_number="5.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019158041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003978 - UDP-glucose 4-epimerase activity
                     [Evidence IEA];
                     GO_process: GO:0006012 - galactose metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase GalE"
                     /protein_id="UOE44506.1"
                     /translation="MSILVTGGAGYIGSHVVRLLLERGDEVVVVDDLSSGIPARLDGV
                     PLVELDLSDTGRRTDLVDVLRAHEVSAVVHFAAKKQVAESVARPAWYYEQNVGGLAGL
                     LLALEEADVRDIVFSSSAAVYGATPSVLLDESTPTVPINPYGATKLVGEQMLAAAAAT
                     GAVRATSLRYFNVAGAGWPELADTAVLNLVPMVFERLDAGEGPRIFGDDYPTADGTCI
                     RDYVHVLDLARAHLAALDTVRDGHRVFNVGTGTGSSVREMIDAILEVSGSTIEPVVEP
                     RRAGDPAEVVADPRLIARELGWRSEFGLRDIVESAWAAHVRR"
     gene            353827..354816
                     /locus_tag="MTO99_01560"
     CDS             353827..354816
                     /locus_tag="MTO99_01560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010203471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="UOE44507.1"
                     /translation="MTGVRVSVALGTHNGARFLEAQLRSILAQTRAVDEIVLSDDASS
                     DGTVELAERLVAEHRGSGGAAPDLVVLRNDPPLGVTANFEQALRSATGDLIALSDQDD
                     IWRADRIERAVEVFDARPGLQLVASGARLVDDQGEPIGATLFGTLGLEGTTLERIRVG
                     AAFEELLKRNLLTGATMMVRRSLVEAASPFPPTWVHDEWLAVVASVIGGIAVIDDELI
                     DYRQHGGNQIGVTALELTGKIGRLRAPRTERNVRLRARAADLARRLPAIASDRADLAE
                     VVADKLVHEQVRSAYPRSRFGRIVPVLREARTGRYGRYGLGAQDILRDLVQPV"
     gene            complement(354893..355843)
                     /locus_tag="MTO99_01565"
     CDS             complement(354893..355843)
                     /locus_tag="MTO99_01565"
                     /EC_number="2.4.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="UOE44508.1"
                     /translation="MPTGESDLTVPAENPHTVEVPFLDILMPFWGDPGQFRDAVESVL
                     AQTDPGWTLMVIDDAYPDRSPGEWVRALEHPRVHYRRNAVNLGVSGNFREAARVASAP
                     YTTVMGCDDLLLPGYVERIRQLVATHPEAAYVQPGVEVIDGEGRVTAPLADRVKSMYR
                     PRVNPAGPVELSGERLATSLLRANWTYFPSIAWRTDLLKRFDFRDDYEVVLDLALQIE
                     IVREGGILVLDDRPEFRYRRHAASASAKRATEGSRFQEERRYFSEAARAMHEQGWGRA
                     ARAASRRLTSRLNALSVLPSALVARNGAAARTLLRHGLGR"
     gene            355882..357207
                     /locus_tag="MTO99_01570"
     CDS             355882..357207
                     /locus_tag="MTO99_01570"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44509.1"
                     /translation="MYQSKGKPAVVDDARESTERRPTSVLWMLAGTLVGGVAGYLVLW
                     LTARSLGAAEYAVFGVFWSALYLIVGVLFGLQQEATRAASASASVSASASGSPEGPAG
                     ASAVGAARRGSSLWVLATASGLLVIAVAIGTAVWWAPESFGTAHSDLSIPVAIGSGLS
                     AVVAVASGLFAGHRRWLLLGVIIAADGVLRLAAVGVATDFGAGTEVLAWAVVAPYVIV
                     IVGCFAIGGRRLIRDGRVDVSFRRLAANSVQTVVAASATALLINGFPLVLALVEASDD
                     ATLLGALIFAITLTRAPLLVPLTALQSYLVTAFGAARREAPRLLARWSAIVVGVAVVL
                     AAIAWLAGEWALDAFVGADFALPGSLLAGLVVSSGCIGMLCVTGPAVLARSLHTAYAL
                     GWVIASATTIALLFLPLTIEASVPLALAVGPLVGVAVHLGLLRWSGSAR"
     gene            357238..357849
                     /locus_tag="MTO99_01575"
     CDS             357238..357849
                     /locus_tag="MTO99_01575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018191707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="UOE44510.1"
                     /translation="MDAGSDETPPTAAPGYAERLKTIESARWRRLIDVQAPYRWNIRR
                     LKLGRTLDVGCGLGRNLAHLRGNGVGVDHNADSIAIARERGLEAYTVDEFAASTAAVP
                     EAYDSLLFAHVMEHMDRESDIALVTAYLPYLRAEGQVCFITPQERGYRSDATHVQFVD
                     FAGLEEIAHAAGLAVERRFSFPLPRVAGRAYTYNEFVAVARRR"
     gene            complement(357885..359198)
                     /locus_tag="MTO99_01580"
     CDS             complement(357885..359198)
                     /locus_tag="MTO99_01580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolysaccharide production protein"
                     /protein_id="UOE44511.1"
                     /translation="MTRESPFAHAWHATRGAIGSARFAQALTLISIGLAFSTHAIRAL
                     IGTAGLVAALVGLLVLAGASLVARWRAVEWYGILPLTILVFVGWCAASLLWTQNTRYT
                     VIGVASLIAFGVLGVYIALMRDTIQIVRAFGDVLRVLLGVSLALEVLSGILLDLPIAF
                     LGIRGDLANLGPIQGIFGTRNLLGFVALVALVTFVVEWRTKIARGGKAVASVALATLC
                     IVFAASPTAWIALGATAVALAALVGLRRVAPATRWVWQLVIIGVGLAALVTGWLLRIR
                     IIELLDARAEFDVRLDLWREISRYLASNALQGWGWVGVWPSERTPYTWIAVMTGRDHG
                     SALSAYIDAYFQVGVIGVLLFVALVGVALVRAWLLASSRRSPVYVWPALILVAIAVTS
                     FAESFALVEGGWLVLVVCAVKAARDMSWRDALARPGVGLPQSDRA"
     gene            complement(359195..360544)
                     /locus_tag="MTO99_01585"
     CDS             complement(359195..360544)
                     /locus_tag="MTO99_01585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen ligase family protein"
                     /protein_id="UOE44512.1"
                     /translation="MTSARRSALVGAYATFALFTLLAGQFWRNLLGWWGFGAIAVLVV
                     AGAVALLVVTRPTWIWRRVPKSTFAFLIIATASIAWSAYPGASVLGVAITLATVTVAI
                     ALVLCLAWGAIVRALAAAIKWILALSIVFELWAALVVRGPVLPLFPDFEVTDSLPKAF
                     FWSRGLLLQGGPIEGLVGNRNLLAMIALLGLIVFACLLAAGSVRRAQGIGWLVVAALV
                     FALTRSATATLAGVAVLAAVAFAAWARRIDPLARRPLYWTAAAAGAATLALVALGWNT
                     LLQVFGKSDDLTGRFDIWASVWQLITERPWFGWGWVGYWNPWVEPFDGLAVRNGVTYL
                     QAHNAWLDVWLQVGVFGLIAFVSIAVGAQWRSWFLAVDQPRDATGHPIAFSAASLVPL
                     LLLVALLAQSLAESRLLIEGNLALLIMIAWSTKRRQWAHDPLPADAARPRFDVAGPR"
     gene            complement(360707..361885)
                     /locus_tag="MTO99_01590"
     CDS             complement(360707..361885)
                     /locus_tag="MTO99_01590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012298079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase family protein"
                     /protein_id="UOE44513.1"
                     /translation="MSFEPLASDFYGYHDLLTDREREALGELRAWLEADVKPIIGGYW
                     ERAEFPMQVVKPLADLGVLSYAWDETAPFENSSVFRGFVALELARVDASVGTFVGVQN
                     GLATGSISIAGSKEQREEWIPKLASGEIIGAFGLTEPLSGSDSAKGLRTTARREGDEW
                     VLNGQKRWIGNATFSDITVIWAKDEADGQVKGFIVPTSTPGYSATKIEGKISLRPVQN
                     ADITLTDVRVPESLRLQNANSFRDTAAVLRATRAEVAWAAVGTAVGAYEAAVAYAKDR
                     VQFGKPIASHQLIQEHLVNSLGNITASLGMVVRASQLQDAGRLADEHSALAKAYATSR
                     MRETVSWAREVCGGNGIVLDFHVARFFADAEALYSYEGTREMNTLIVGRAVTGEAAFV
                     "
     gene            361999..363243
                     /gene="manA"
                     /locus_tag="MTO99_01595"
     CDS             361999..363243
                     /gene="manA"
                     /locus_tag="MTO99_01595"
                     /EC_number="5.3.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019179511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004476 - mannose-6-phosphate isomerase
                     activity [Evidence IEA];
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-6-phosphate isomerase, class I"
                     /protein_id="UOE44514.1"
                     /translation="MFVAIRNSPRDYAWGSITEIAGFLGAAPSGGPEAELWLGAHPGS
                     PARIADPAQAGGASDLAEWIAADPEAALGTELGDRARLPFLLKLLAAGGPLSLQAHPT
                     SAQARAGFAREEADGVPIDAYDRNYKDEFHKPELIVAVSDDFDALSGFRPLGEVREIL
                     EILRAADASDAAPAPGALDLLEQHLEAGLADTVEWLLRDGRGEDTGQAVWVVERVVRL
                     ARSREAQESAYADSFATVVDLSGAYPGDPGIVISLLLNRVRLRRGEALYLAAGNIHAY
                     LRGLGIELMAASDNVLRGGLTPKHIDVAELLDVLDFTPIAPPRLEPEQPSPGVRTFRP
                     DVPDFVLHRVEPGAGESSVELDGPAIVLVEGAPVALAGERSRADVERGQAVYVTPDER
                     RVVVRGDGVAWIATVGREASAG"
     gene            complement(363368..363736)
                     /locus_tag="MTO99_01600"
     CDS             complement(363368..363736)
                     /locus_tag="MTO99_01600"
                     /inference="COORDINATES: protein motif:HMM:NF013691.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GIY-YIG nuclease family protein"
                     /protein_id="UOE44515.1"
                     /translation="MIWVYILRCSNGAYYVGSTRQPVEARVWQHNQGLGANFTRKHRP
                     VELVYAEAWDRIDDAFAREKQLQGWSRAKKLALIEGRGDQLPSLARTSKRRLPEPVEG
                     GPASTSSASYDRHSEPPTAP"
     gene            complement(364115..365089)
                     /locus_tag="MTO99_01605"
     CDS             complement(364115..365089)
                     /locus_tag="MTO99_01605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013116454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="UOE44516.1"
                     /translation="MLKTVACLAVPQMAPFEFGVICEVFGIDRTDDGGASFDFRILAA
                     DPGPIPTKLGFSINVEQGLEFADTADLVAVPASPVGTEPDERILEVVRRAAARGAWVL
                     SVCSGSFTLAKAGVLDGRRATTHWMYADRLARDFPQIDVDPDVLFVQDDNIVTGAGTA
                     AGIDAALHIVRTELGAAQANIVARRMVVPPQRDGGQSQFIRTPVVECRSDSLSGITAW
                     MVEHLDEDLTVDRLARRALMSPRTFARKFRAETGTTPNAWLNRQRLLRAQELLEASDL
                     TLEEIARETGFGAASVMRHHFVKVLQTTPTAYRRAFGHRLTDLEALAS"
     gene            365182..365334
                     /locus_tag="MTO99_01610"
     CDS             365182..365334
                     /locus_tag="MTO99_01610"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44517.1"
                     /translation="MSIILLFLITGVVAWAIVGAALSFAHDGYGWRGIPDRLHDADVR
                     GIAEAR"
     gene            365414..366376
                     /gene="galE"
                     /locus_tag="MTO99_01615"
     CDS             365414..366376
                     /gene="galE"
                     /locus_tag="MTO99_01615"
                     /EC_number="5.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013118109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003978 - UDP-glucose 4-epimerase activity
                     [Evidence IEA];
                     GO_process: GO:0006012 - galactose metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase GalE"
                     /protein_id="UOE44518.1"
                     /translation="MTWLVTGGAGYIGAHVARAFAAKGIEAVVLDDLSTGREAFVPTG
                     TPFVQGSILDGPLVEQTIERYGVTGVVHLAGFKFAGVSVQEPLRAYHQNVTGTATLLA
                     AMEHGGVDRMVFSSSAAVYGTPDVDLVTESTPKHPESPYGESKLIGEWLLADQARAHG
                     LRHTSLRYFNVVGSGTPEVYDVSPHNLFPLVFDALLSGRTPRINGDDYPTPDGTCVRD
                     YIHVADLADAHVVAAQRLDAGEAIEPVYNLGSGDGVSVGEIMRAVAQVTGIDFTPEIA
                     PRRPGDPARIVASGELAARDLDWRMRHTLAEMVESAWQARKAAV"
     gene            366546..366866
                     /locus_tag="MTO99_01620"
     CDS             366546..366866
                     /locus_tag="MTO99_01620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012037715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WhiB family transcriptional regulator"
                     /protein_id="UOE46030.1"
                     /translation="MGNPEYRSGVPEDWFVDPVRLGVPGVRPGVGDDDPLSWQSDALC
                     AQTDPEAFFPEKGGSTRDAKRICTGCEVRAQCLEYALSNDERFGIWGGLSERERRKLR
                     KRAV"
     gene            366996..370229
                     /locus_tag="MTO99_01625"
     CDS             366996..370229
                     /locus_tag="MTO99_01625"
                     /EC_number="2.4.-.-"
                     /inference="COORDINATES: protein motif:HMM:NF025025.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="UOE44519.1"
                     /translation="MFPRVTAILVVQHAGDRLQATLDALQAQERRPDAVIAVLADAGQ
                     EALDQVAAVAPTHVIQLANRVPFGEAVRAADAVLEPAAGDADALWLLAEDTAPAPDAL
                     AVLVALLELNRSVAIAAPKLVEWDQPDRIAHLGRSITRYGRTVDLVGDELDQGQHDEL
                     SDVLGADAPGILVRHETWRALGGFDPGLPVVDDALDLSIRARLAGHRVSVAPTARVRF
                     AGAGVAGEPVGGARTVRRRHALTRRAQLRRRMVYAPAAALPLHWLTLLPLAIVRSIGM
                     LLIKAPGRIVGELGAALRAMFSFGSIGAARRTLKRARSTGWSAIAPLRVPPDEVRRRR
                     RLDAEARRARARGRTDGARFLATGGGWVLLATVVIGIVLNARLFGAGGVAGGALLPLS
                     GELGELWRNAGYGWRDVGAGFVGAADPFAGVLAVLGSLAFWSPSWALVALWIIAVPAA
                     ALGAWFTVSRLTERGALRALGAIAWSFTPPFLVALADGRPAAVLAHVLLGWLAYAGLG
                     AARSWAAAATAGLLAVGVVAAAPSLTPALVVSWLVGLAVSGRRAVRLLVVPLPALALS
                     LPLAWQQVSRGTPLGLAADPGAPVPGAVPDPWWLVLGFPGGSGGGWPATIDAIAGLGD
                     RVDPHWIATALLAPLVVLAVLAFARRRVLPALAAIGAALLGLAVAVAAAHVSVATVGA
                     DPVAVWTGAGQSLMWLGVIAGAVLCLDGLRHGTAWLATVAGAAALAAVLPTAIALTTG
                     QAAVHPAADRTMPAFVVAESVEDPRVATITIQPVSGGSVHAELVHGSGDTLDAASTLA
                     STRTGLTEDETTLAEIAGNLASRSGADAGAAVQEFGARFVLLVPPAGDAERDRRAQAA
                     HDRAHAALDGNAALIVVGDTAFGRLYRFADAPSPAPAAAIPADAGAPTAGWITAAQWV
                     VLGFVLLLSIPTGVGREAERRRRPPRRPKRAGPTPDDAAAGDAEAAASAAPPAGAEAE
                     APTGAEAVPTDDAADADAGAPDAADASDGVEQEVPGQGHQSVEPAEPVEPAEPVEPGA
                     SVEPGASDEPGASDEPADTVRSGASTGPGASDEPADRPAEGGDDDAR"
     gene            370219..371664
                     /locus_tag="MTO99_01630"
     CDS             370219..371664
                     /locus_tag="MTO99_01630"
                     /inference="COORDINATES: protein motif:HMM:NF040160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF5719 family protein"
                     /protein_id="UOE44520.1"
                     /translation="MPAERRTRALRAVGRGAVALAAAIVCTAAVAAAVIVPWPEHRAE
                     PESVVVAPVESRQQRVCPGPLLELAEDAGAATTASSFGSADLVTATFPADIEVDEVPI
                     DAPDDDEADVDRGPVAIEVEPTAAEIGMLAGAQSQRAQQETLAGLAVAACREPAAESW
                     LVGGSTALGRTTLVLLANPAEVAATVDLRIYGEAGPIDAPAGLGLVVPAGTQRVVSLA
                     GLAPDLAAPVVRVTSSGGRIAATLQQSAIDGLVPAGVELIAPAASPADQVRIPGVVVA
                     EAGGVASDEDHLDGDAFPALRLLAPGADDVDATVSVVPEHGAARTSIEVTLLAGEAID
                     VPLGELSPGAYSIDLVADGPVVAAARSSIAPGEEEDEAGDFAWFPATTALIGDLAVAV
                     PDVAAPVLHLAAPGREDVHAVVATRGAEREITVPGGGAIAVTVSPGDELVLRGVDGLF
                     ASVSSIGARMLSSFAIEPPGPVDAPIRVYPR"
     gene            complement(371712..372068)
                     /locus_tag="MTO99_01635"
     CDS             complement(371712..372068)
                     /locus_tag="MTO99_01635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44521.1"
                     /translation="MTGPHLPLLHSRLDDFDLTIASTASYLRGLWPELEGVVFEVAQG
                     PADAIHEDHIDRWKVYHDERRIVFFRLPIVRFIRVLEGEERQEKLLVESCVFRAVADL
                     LGREPWELSPGRYRPY"
     gene            372240..372419
                     /locus_tag="MTO99_01640"
     CDS             372240..372419
                     /locus_tag="MTO99_01640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3499 domain-containing protein"
                     /protein_id="UOE44522.1"
                     /translation="MATLTYDYADSMVVLGPLAFRAEPHAYDLCARHAERTSVPRGWQ
                     VVRHAPIGGAPASPR"
     gene            372447..373880
                     /locus_tag="MTO99_01645"
     CDS             372447..373880
                     /locus_tag="MTO99_01645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016868 - intramolecular transferase
                     activity, phosphotransferases [Evidence IEA];
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase/phosphoglucomutase"
                     /protein_id="UOE44523.1"
                     /translation="MTDSAVPGARGALDAIVKAYDVRGIVGDGLDETVVEALAAAFVD
                     EVGAAGGRVVVGHDMRDSSPGFAAAFARGAVARGADVLAIGLCSTDESYFASGRYDAP
                     AAMFTASHNPAAYNGIKFSRAGAQGISLDTGLAAIRDRAGDFLERGIPSVSEPGSVTD
                     LDVLADYAAYLRSLVDLSGIRPLKIVVDAGNGMGGLTVPAVLGEAAGLPVLPLQIVPL
                     YFELDGTFPNHEANPLEPANLVDLQRAVVAHGADLGLAFDGDADRCFVVDERGEAVTP
                     SAVAAIVALREIARVRAAGEADVSVIHNLITSRIVPETIEQAGATPVRTRVGHSLIKD
                     RMAQTGAVFGGEHSAHYYFRDFWGADNGMLAAMHLLAEFGSQDAPLSQLAQRFTPYAL
                     SGEINSTVADIPAAYTRIVEAFTGRAEFDELDGLTVTGVTAETEPFWWANIRPSNTEP
                     LLRLNVEASDPATMARYRDEFLALIRA"
     gene            373963..375438
                     /gene="ahcY"
                     /locus_tag="MTO99_01650"
     CDS             373963..375438
                     /gene="ahcY"
                     /locus_tag="MTO99_01650"
                     /EC_number="3.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012298091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004013 - adenosylhomocysteinase activity
                     [Evidence IEA];
                     GO_process: GO:0006730 - one-carbon metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylhomocysteinase"
                     /protein_id="UOE44524.1"
                     /translation="MSLTTSTLPFKVADLSLAAAGRHQLRLAENEMPGLMALRAEFGE
                     SKPLAGARIAGSLHMTVQTAVLIETLVALGAQVRWASCNIFSTQDEAAAAVAVGPDGT
                     VDDPRGVPVFAWKGETLEEYWWCTDRIFDWSSEAEAAGADWIGPNLILDDGGDATLLV
                     HKGREFESAGAVPEPGPDTNHEFRVILDTLRASLERSTDRWTRIAADLRGVTEETTTG
                     VHRLYELHAAGELLFPGINVNDSVTKSKFDNKYGIRHSLPDGLNRATDVLMGGKVAFV
                     AGYGDVGKGAAEALRGQGARVIVSEVDPICALQAAMDGYQVSRLESVIGEIDILVTGT
                     GNKDVVRVEHLLGLKHLAIVANVGHFDNEIDMAGLESLPGAERVEIKPQVHEWRLPNG
                     RSVLVLSEGRLMNLGNATGHPSFVMSNSFTNQVLAQIELWTRPAEYPVGVYVLPKHLD
                     EKVARLHLDALGVELTELTPEQAAYIGVPVEGPYKVDHYRY"
     gene            complement(375544..376386)
                     /locus_tag="MTO99_01655"
     CDS             complement(375544..376386)
                     /locus_tag="MTO99_01655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018171958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RDD family protein"
                     /protein_id="UOE44525.1"
                     /translation="MSQAAPADRSVSRLVDDGLLTGEAVALDVRPASAVMRGGGTAID
                     VFATLVVIGGVLWLASSFSLDEAAVRAVAVTGLVVCLVVVPTAVETASRGRSLGKLVM
                     GLRVVRDDGGAIGFRHAFIRALTGVLEIYLTLGGLAVVVGFLNPSSKRLGDLLAGTHA
                     QVERVPRFEPQSFGVPTQLAGWAVTADVGRLPDPLERRIAAFFRNAPHLEPPRRAAIA
                     ASLAAEAAPFVSSVPDAPAELFIAAIAALRRERDLTALSLEDRRMADLAPVLTARPNG
                     FPER"
     gene            376406..377401
                     /locus_tag="MTO99_01660"
     CDS             376406..377401
                     /locus_tag="MTO99_01660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012037726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stage II sporulation protein M"
                     /protein_id="UOE44526.1"
                     /translation="MDLDALAAARHDDWQRLDALSRGRFLGGAEADELIERYQSGASD
                     LSLIRTTAGSTALGDRLSIRLARARLRFTGAPENPLRRFIRFWLVSLPAALYRLRWLT
                     LAVALVTFAVAALFAWWAAGDPRVLATLGSDDELAQLADEGFVAYYSEHPAASFAGAV
                     WTNNAWIAAQCVAFGVLGVWVPVVVLQNAMNLGLNAAVMAAYGELDTFFLYITPHGLL
                     ELTCVFVAAAAGLRIFWAWVAPGARTRGAALAEDARSLFTVAIGLVFFLFVSGIIEVF
                     VTPAPWPWPVKIGIGVLAFGGLLFAMLGLGRRAARAGETGDLVEFEAGSRRLVAG"
     gene            complement(377502..378893)
                     /locus_tag="MTO99_01665"
     CDS             complement(377502..378893)
                     /locus_tag="MTO99_01665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF58 domain-containing protein"
                     /protein_id="UOE44527.1"
                     /translation="MAVSGRFVWLVAAGAVVVVLAGWAGGSAPSGSAAGGSALPGDGA
                     AAAWLALSAWLLLAAGIGAIDLSLAGSPRHVAIERTLPERVRLDEQATSELVVVNLGS
                     RPLRAVVRDGWQPSAGVVGPNRTRVRIPPGERRRMSQTLVPTRRGDRRTERVTIRSWG
                     PLGLWARQTSLVAPGRLRVLPPFRSRVHLPSRLTRLRELDGRTPLLIRGQGTEFDSIR
                     EYVRGDDVRAIDWRATARRSDPESRGGSKLMVRTWRPERDRRIVIVVDTSRTAAARIA
                     DEPRLDTAFEASLLLAALASHAGDRVDLVAWDRRVRGRVHGTTGPELLARMVDVMANL
                     DAELIEADWSRVPAQVRRLTSRRALVVILTGADSPANARGLLAMLPQLTSRHTVVVAS
                     VADPDEVLAARRIDDLDEVYRAAAAERSLLDGARVGAAIRRLGAETVTAPPLELPPAL
                     ADRYLELKAAGRL"
     gene            complement(378894..379865)
                     /locus_tag="MTO99_01670"
     CDS             complement(378894..379865)
                     /locus_tag="MTO99_01670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019182336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="UOE44528.1"
                     /translation="MTDPNPADADLRAALNRVRAEVGKAVVGQDGAVTGLIIALLANG
                     HVLLEGVPGVAKTLLVRTLSRTLHLETRRLQFTPDLMPGDVTGSLAYDPRTGDFTFRE
                     GPVFTNILLADEINRTPPKTQSALLEAMEERQVSADGVTRPLPDPFLVAATQNPIEYE
                     GTYALPEAQLDRFLMKLVLDVPERDAEWAMLRRHADGFDPHDLAAAGVEAVLDAAELA
                     AARAAAARVGVSDDVLAYVVDLARATRRSPSMRLGVSPRAATGLLAAAKAWAWLTGYD
                     SLTPDHVQAMLLPVWRHRVQLRPEAELEGVAVDQVLRGIVQQVQVPL"
     gene            complement(379862..381190)
                     /locus_tag="MTO99_01675"
     CDS             complement(379862..381190)
                     /locus_tag="MTO99_01675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4350 domain-containing protein"
                     /protein_id="UOE44529.1"
                     /translation="MSLAAPPKARPDGAAEPVAAVADTPTVRAALRRARTWIVLGAVL
                     VVGAIVVLVVQGGLRAPGPALGADNAAPSGARALVQVLRGQGVEVTVAHRLDAAVDAA
                     DGATVLLYDEFGLLDRASLRRLAGAADGLVIAAPGFAALEALAPGVRLAGTAVGDLDE
                     ADCDLRAAERAGELGAGQRLLTVDDAAADAGWVGCFPDDDHGFALVVGPSVSGGELSL
                     VPSTAVFANDTIDERGNAALALGLLGSREHLVWYLPGPADAEPAAATAGELTPGWVSP
                     VLVLLLVVGLAAAIWRGRRFGPLVIEDLPVEVPAGETAEGRARLYARGTGRLHALDQL
                     RIGSVGRLTALLRLPRSAPLSEVITATAAATGRAPIDVESVLVAAVPAGDRELVDLAD
                     RLAALEQQVRDALGPAASGPAASRPAASGPATTRDPAASDPTTDPRGRRP"
     gene            complement(381187..381876)
                     /locus_tag="MTO99_01680"
     CDS             complement(381187..381876)
                     /locus_tag="MTO99_01680"
                     /inference="COORDINATES: protein motif:HMM:NF024948.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4129 domain-containing protein"
                     /protein_id="UOE44530.1"
                     /translation="MQLEIPVDPDAPEARRWLQDELAKAEYQAAQPTWFDRLMAAIRD
                     WLAGLFDGSIGVPGAVVVAIVVVAVLALVVIGLLVFGLPRLRRRRAAPAPLFDDGDTR
                     DLDTLRRAADAAAGRQDWPSAIEERFRALVRGLVDRDLVRVHPGTTAHGVADAASRRF
                     PAYRAGLGGAADEFDGVRYLGRPGGREAYERLTALERALASAAPHRDEPHGASPHGAG
                     PHGAEIAQGVR"
     gene            complement(381884..383131)
                     /locus_tag="MTO99_01685"
     CDS             complement(381884..383131)
                     /locus_tag="MTO99_01685"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44531.1"
                     /translation="MSDQEWQAPGGGAWPPQVPPAPAAQPGYPQPGYPQPGYQQSGYS
                     QQPGHDQQPGYPAPGAPAGWTPPPKPGLLPLRPLGFGTLLWAPFRTLRRNPAPTFGTG
                     LLVQLATVVATAAVVVPFMFILLDRTGSAAGEDADTLFAGAVGGFLLLMLVPIAVSVV
                     ASALVQGVMVVEVATGTLGEKLGFGALWRRAARRIWPLIGWTLLLSAAVLLAVLSVVV
                     VVVIAAMLGPVGLAVGVVFAIVAGLGLVALGAWLGVKTSLVPSIIVLEEAGIRRAVAR
                     SWRLTDGYFWRTLGVELLVAVILSTASNVVVQPISFLGGMLSVLIDPTGTGSGAVVLI
                     VLTVVSTVLSLLIGAITLVVQSAVIAVIYLDLRMRKEGLDLELERHVELRDAGHPVGD
                     PYLPRPVAPVPAPASPGAPYGWA"
     gene            383293..383973
                     /gene="mtrA"
                     /locus_tag="MTO99_01690"
     CDS             383293..383973
                     /gene="mtrA"
                     /locus_tag="MTO99_01690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0000156 - phosphorelay response regulator
                     activity [Evidence IEA];
                     GO_process: GO:0000160 - phosphorelay signal transduction
                     system [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="MtrAB system response regulator MtrA"
                     /protein_id="UOE44532.1"
                     /translation="MSSRVLVVDDDTALAEMIGIVLRADGFDPVFCADGGGALAAFRE
                     SKPDLVLLDLMLPGVDGIEVCTRIRAESGTPIIMLTAKSDTADVVRGLESGADDYIVK
                     PFNPKELVARIRTRLRPAPEPAVETIAVGDLVIDAAGHEVRRGDQRIALTPLEFDLLL
                     TLASKPQQVFTREMLLEQVWGYHYKADTRLVNVHVQRLRAKVEHDPDNPRIVMTVRGV
                     GYRAGATT"
     gene            383980..385737
                     /gene="mtrB"
                     /locus_tag="MTO99_01695"
     CDS             383980..385737
                     /gene="mtrB"
                     /locus_tag="MTO99_01695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0016021 - integral component of membrane
                     [Evidence IEA];
                     GO_function: GO:0000155 - phosphorelay sensor kinase
                     activity [Evidence IEA];
                     GO_process: GO:0007165 - signal transduction [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="MtrAB system histidine kinase MtrB"
                     /protein_id="UOE44533.1"
                     /translation="MTGSAPAVRAVGGWRAVPRRIAGLWRRSLQFRTVLLTIGLSTLA
                     ILVIGLFITFNVASNLFTNQLERVLDASNAATDAAQTIVGSTDATERVALQNVMDQAV
                     KSVQAVSGSSAIGLFRDTDEDPSTLAPQDQLSPQLAGVITPELRDVVQDNPGTQFWQS
                     VALPRVPAALETGTDPGVVVGSDLQVPGAGRYLLYIGYNFADAEATLAFMQVTGLIGA
                     IALILLLSAIILLVVRWVIEPVRTVAATSRRLAAGDLGVRMPAKGEDELATLSASFNG
                     MADSLQARIRELAELSVMQQRFVSDVSHELRTPLTTIRLAGDVLHGQRDEFDATTART
                     VELLHTQTERFEALLGDLLEISRYDAGSVELATEPTNLVHLAGDAVESMHDLAREHGS
                     ELRLVAPGGHLDAEVDPRRIQRIVRNLVGNAIEHGEGRPIVVAVDSNEQAVGLSVRDY
                     GMGMTEEERVRVFDRFWRADPSRSRTIGGTGLGLAISLEDAAAHGGTLDVWSKPGRGT
                     VFRLVVPRTRGREVIEPPLPLEPDDPDATGPEPAPPDLARPGDTGAFGVEAVPPAWRG
                     VGDAARGRPGDDRAGVRDA"
     gene            385730..387418
                     /locus_tag="MTO99_01700"
     CDS             385730..387418
                     /locus_tag="MTO99_01700"
                     /inference="COORDINATES: protein motif:HMM:NF022113.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LpqB family beta-propeller domain-containing
                     protein"
                     /protein_id="UOE44534.1"
                     /translation="MRRTRRRFAAASVALAVVAALVGCASIPSSGGVHAGGSQTSADA
                     LDLDRVASMPRAGADQEQILRGFIDAATDPRNNYYVARQFLAPGFADEWDAGAGATVD
                     EAVDRTYQQTGEDQMVVQAIPTASLLPNGQYEPAASSAPIPLTYTFTQVEGEWRISAA
                     PLGLLIDAFDFARVYRTHTLYFFDPGFRYAVPDVRWFAGRDAVQTSIVRALLDGPADW
                     LAPGVESAFPEGSRLEADTVPIVAGVASVDVDAVADDTRSIQRMEAQLSLSLESVRSV
                     QRVRLSLNGAVQDVPESASTPTVNPRVGSQPVAFDGERFGHVGDDGVVPIAGLSEQVA
                     ARAPLAAAVGPGDETAAVLTADGVWRVSADGEPEQLDPRDGLVTPVLDSLGVVWSTPA
                     ATPDQVVVYGPAGAAAEPVQVAVPWAGGRLIALQVSRDGTRVIALIADGVRARLVAAA
                     VERNEDGIPVAVGPEVLQLADVTGTPLDAAWLDDRTVAVLSSTDAGTRLTTQVLGAPA
                     SSDPGPADGRTLVGGNAEREVRVLTAAGELSGRSGVGWQVQASGLRFLAAQQPD"
     gene            387510..388271
                     /locus_tag="MTO99_01705"
     CDS             387510..388271
                     /locus_tag="MTO99_01705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012037738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ComF family protein"
                     /protein_id="UOE44535.1"
                     /translation="MPRPAPTAAASAARGRAAATPVRDAVRGAVRDALAVVLPVSCAG
                     CGAPDRSVCDGCLAPLRPAPRRLSREGVAGWAALEYGGTVARVITAYKDGGRTDAALP
                     LAAALVAAIGAALAELDVDGVELCTVPSTAAARRARGFVPVDRLLRTAGLRPARVLGL
                     VRDHADQAGLDLASRRRNAAGSLAAGRPLHGRRFILVDDVCTTGSTLAEASRALIAAG
                     GEVVGAAVIAETPRRNPAVPRPEPEPVAGRVVTFS"
     gene            388363..389058
                     /gene="raiA"
                     /locus_tag="MTO99_01710"
     CDS             388363..389058
                     /gene="raiA"
                     /locus_tag="MTO99_01710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017888817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0005840 - ribosome [Evidence IEA];
                     GO_component: GO:0022626 - cytosolic ribosome [Evidence
                     IEA];
                     GO_function: GO:0045182 - translation regulator activity
                     [Evidence IEA];
                     GO_process: GO:0009386 - translational attenuation
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated translation inhibitor RaiA"
                     /protein_id="UOE44536.1"
                     /translation="MELNIVGRNLGVTDRFRAYVTEKAEKVSHLAERAISLDVKLTRH
                     NEKNGNPGSDRVELTLVGRGPVVRAEADGTDKYAAFDVALGRLLERIRRAKDRRKVHR
                     GQRRPTSLREAADDGFSGVGMQAADVEVLERVRTGAIPVVDEAPAEDDDVYCPVVIRR
                     KVFASGPMTVDDALYFMELVGHDFYLFVDAETGRPSVVYRRKGWDYGLIGLDERAEAS
                     GDADAREPQRVTA"
     gene            389227..392025
                     /gene="secA"
                     /locus_tag="MTO99_01715"
     CDS             389227..392025
                     /gene="secA"
                     /locus_tag="MTO99_01715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012037740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_process: GO:0006605 - protein targeting [Evidence IEA];
                     GO_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA];
                     GO_process: GO:0017038 - protein import [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="UOE44537.1"
                     /translation="MASILEKVLRVGEGRTLKRLENYAKAINALEDDFISLTDEELKH
                     ETVELRERYANGESLDDLLPEAFAAVREASRRTLGLRHFDVQLMGGAALHLGNIAEMK
                     TGEGKTLVATTAAYLNALTSRGVHVVTVNDFLASYQSELMGRVFRALGMTTGCIVAGQ
                     NPAQRREQYAADITYGTNNEFGFDYLRDNMAWQASDMVQRGHYFAIVDEVDSILIDEA
                     RTPLIISGPASGEANRWFNEFARLAERLVPGEDYEVDEKKRTVGVLEPGIEKVEDYLG
                     IDNLYESANTPLISFLNNSIKAKALFKRDKDYVVMNGEVLIVDEHTGRILVGRRYNEG
                     IHQAIEAKEGVQVKAENQTLATVTLQNYFRLYEKLSGMTGTAETEAAEFMSTYKLGVV
                     PIPTNKPMVRIDQPDLVYKNEESKFAQVVEDIVERHKKGQPVLVGTTSVEKSEYLSRL
                     LAKKGVRHEVLNAKNHAREAAIVAQAGRLGAVTVATNMAGRGTDIMLGGNAEFIAVQK
                     MHEKGLSPAETPDEYEAEWDTVFEAVKAEVDVEAQKVLAAGGLYVLGTERHESRRIDN
                     QLRGRSGRQGDPGESRFYLSLTDDLMRLFNAGAAESLMARGVPDDVAIESKVVTRAIR
                     SAQSQVEARNAEIRKNVLKYDDVLNRQREAIYSDRRHILEGDDLHERTQRFLEDVIDE
                     VLDQHTAEGNPDEWDFDALWTELKTLYPINITIDEVVAEAGEKGRVNRDFIRREILSD
                     ARLAYQRREEQLGSPAMRELERRVVLSVIDRRWRDHLYEMDYLKDGIGLRAMAQRDPL
                     VEYQREGFAMFQQMMGAIREETVGFLFNLEVEVAQQGAAPTIEAKGLSRPQAPAEKLS
                     YSAPSDSGGVEVRNQRGQVQQAATQRARRAVAAQQAPQQPQQPPARGAFGQPASGDAA
                     GQEPQNRAQRRAQERRGN"
     gene            complement(392329..392778)
                     /locus_tag="MTO99_01720"
     CDS             complement(392329..392778)
                     /locus_tag="MTO99_01720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010203425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rv3235 family protein"
                     /protein_id="UOE44538.1"
                     /translation="MPALSADASARASTSRAYGPALDDDELFGRQRSSRAELPDPAPM
                     LRSLAHCVIEIFAGARDLEQIARWVTDDVYRNLSKRVVLSARARRAKGLSPQRPVFGV
                     GNVHVCEPIDGVVEAVVLVHQRHRVRAVAIRLEGFDARWRASAIGVL"
     gene            392942..393529
                     /locus_tag="MTO99_01725"
     CDS             392942..393529
                     /locus_tag="MTO99_01725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018188711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44539.1"
                     /translation="MRWDLLFDDLESQLDQEQRDEERALAIEEERLRLARLSLRERLV
                     AMAAESDAPLRLELADGERRSIRPTGFGRDWLSGDPVGAELGPRRCVVPLAAVAAVLP
                     TREQVRAGLVPAPPRANALQERIGLAFVLRDLSRRRTAVAVTTVEGRYHGTIDRVARD
                     HLDLAEHDAGVPRREREVRGYRIVSFDRIVLVGFE"
     gene            complement(393548..393850)
                     /locus_tag="MTO99_01730"
     CDS             complement(393548..393850)
                     /locus_tag="MTO99_01730"
                     /inference="COORDINATES: protein motif:HMM:NF024139.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="UOE44540.1"
                     /translation="MTRRRTSEVGRFMSVADAAELLAVDVATVDELIRTGELPAIRVG
                     ESGPWRIEVAQLQLWVDDRYEDTRRYSSWHQGEFSNVFELSTAGRGGRVRPVDGDL"
     gene            393990..394625
                     /locus_tag="MTO99_01735"
     CDS             393990..394625
                     /locus_tag="MTO99_01735"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44541.1"
                     /translation="MPRRPDHDRGAVRLDPRLLIGMVVVAGSVLGVWALVSGLDASTE
                     VYAVRETVTPGTELTADDLEVRSVRLGAPADTGRYLAADDLPDGGLVVLRTIGAGELV
                     PVSAVGDRADADVASVVVVTRGLLPEGVAAGARVDVWSSAALEHGTFDTPAVLVPGAE
                     VAALIDTDGMITESGAQVELLVPRDRIAAVLQALAAGDAIDLVAAREGGAH"
     gene            394625..395884
                     /locus_tag="MTO99_01740"
     CDS             394625..395884
                     /locus_tag="MTO99_01740"
                     /inference="COORDINATES: protein motif:HMM:NF013793.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-loop NTPase"
                     /protein_id="UOE44542.1"
                     /translation="MARLIVALDPATEDRLLADLVEHGHDLVARAADWREVAAGLDGA
                     SIDVVLVGAGRDTLSAELLTACDERAVRLIAVARDDRERAMAAQLGLHEIVDSSASWA
                     EIERLVSGGVPVASRAAGPLPPARSGSRVVAVWGPAGAPGRTTIAVNLAAELAATGLR
                     VALVDADPYGGTVAPVLGLLDEAPGFASACRLAASGALDRAELVRIAQRSTASRVAFD
                     VFTGLVGPGRWPELAEDRVATALDAIRTIADVVVVDTGFSLETDESVTGDPFAPRRNG
                     ATFAALAAADRVLAVGLADPIGLSRLLRGHAELLEAVEAERVDVVVNRVRASVLGVDA
                     SMQVRQTLRRFGGIDRPVLLPNDARACDAAVLMGAPLRVAAPRSPLRSALRAYADAAF
                     APPVERAPRRRRALPGLGRPAPVAPPA"
     gene            395951..397459
                     /locus_tag="MTO99_01745"
     CDS             395951..397459
                     /locus_tag="MTO99_01745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing sensor histidine kinase"
                     /protein_id="UOE44543.1"
                     /translation="MSTLSELVLAQGRSSQADVDWLHMLVGDLQLLADLAFADIVLWV
                     PSGDDDFVAVAHSRPSSAATLFYRDFVGQAIKPQWRDLVTGTFRSGRIVDSSSPDWYE
                     EMPTRVRAIPVMRRLSPAGTELAPEPIAVITRHTNLSTTRTPSRQELTFNDCADDLFQ
                     MIGSGDFPDLGAPTGPRRGAPRASDGLIRLDADGVTTFASPNALSAFNRMGFDDELEG
                     ESLAEVTTRLLTGKLVVDESLPLVVTGRAPWRTEIESRGVTVAIRAIPIRHRGERIGA
                     IVLTRDVTELRHQEQELITKDATIREIHHRVKNNLQTVASLLRIQARRTHSDEAREAL
                     TQAMRRVGAIAVVHDTLSEGLSQNVDFDEVFDRALLLVAEVAAAHNTTAHPKKSGTFG
                     VLPSAYATPLALALTELVTNAVEHGLAGQEGDVEVIADRSDLTLTVQVRDTGSGLPEG
                     KVGEGLGTQIVRTLIQGELGGTIDWHTIVGRGTEVTIEVPLHWIAGKATVAR"
     gene            complement(397508..397756)
                     /locus_tag="MTO99_01750"
     CDS             complement(397508..397756)
                     /locus_tag="MTO99_01750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009482385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WhiB family transcriptional regulator"
                     /protein_id="UOE44544.1"
                     /translation="MDWRDKAACLTADPELFFPVGNTGPAVDQIEKAKAVCARCTVTE
                     ICLQYALETGQDSGVWGGLSEDERRALKRRAARARRAG"
     gene            397963..398385
                     /locus_tag="MTO99_01755"
     CDS             397963..398385
                     /locus_tag="MTO99_01755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010203418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44545.1"
                     /translation="MNEAAETPPGVRAAIWTVRVLLALEALAMVAVLGWLVVDLFSLQ
                     PSSYATAIALIVLVVIGTLWVAGCAIGAFRLAPWTRGAAIVWQVLQVSVAVGAFQGLF
                     ARPDIGWLLLVPAVVVAGLLLWNPVRLAFTRRDPASAH"
     gene            complement(398433..398909)
                     /gene="bcp"
                     /locus_tag="MTO99_01760"
     CDS             complement(398433..398909)
                     /gene="bcp"
                     /locus_tag="MTO99_01760"
                     /EC_number="1.11.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017831087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016209 - antioxidant activity [Evidence
                     IEA];
                     GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin-dependent thiol peroxidase"
                     /protein_id="UOE44546.1"
                     /translation="MTDARLAPGDLAPDFTLLDQDGTPVTLSELRGAKVVLYFYPEAM
                     TPGCTTEACDFRDSLNSFAAAGVRVLGVSKDDVDKLKRFAERDRLTFTLLSDPDLAVQ
                     QTYGVWGEKSLYGKIVVGAIRSTFIIDEDGRIEKALYNVKATGHVARLRRELGLAA"
     gene            complement(399154..400224)
                     /gene="rsgA"
                     /locus_tag="MTO99_01765"
     CDS             complement(399154..400224)
                     /gene="rsgA"
                     /locus_tag="MTO99_01765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005048324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0005525 - GTP binding [Evidence IEA];
                     GO_function: GO:0043022 - ribosome binding [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome small subunit-dependent GTPase A"
                     /protein_id="UOE44547.1"
                     /translation="MSWWDTDDDDEDDDAFGYDEADVRVRPNPRGSRPRTKVRPEHAD
                     AVTGTVLGVDRGRYSVLLDDGLDTEREVTAARARELRRKSVVTGDHVDLVGDVSGEPG
                     TLARIVRIGERSTLLRRSADDTDEVERVIVANADQMLIVIAAADPEPRTRLVDRYLVA
                     AYDAGIEPLVCITKTDLADPGTFLENFAGLDLPVFRSAPDHIPLDEITAALVGHRTVF
                     VGHSGVGKSTLVNALVPGADRATGDVNAVTGRGRHTSSSTVSLRVESPDGHGWVIDTP
                     GVRSFGLGHVKPDSILAAFSDLAVVAERCPRGCTHLPDAPDCAIVEAVEAGELGPTGR
                     ARLDSLQRLLATFAPAPGTAAD"
     gene            complement(400221..401591)
                     /gene="aroA"
                     /locus_tag="MTO99_01770"
     CDS             complement(400221..401591)
                     /gene="aroA"
                     /locus_tag="MTO99_01770"
                     /EC_number="2.5.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003866 - 3-phosphoshikimate
                     1-carboxyvinyltransferase activity [Evidence IEA];
                     GO_process: GO:0009423 - chorismate biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /protein_id="UOE44548.1"
                     /translation="MQISRYSEPEFDPYGDARETEPRGGWLAPTAIRPLDAALTLPGS
                     KSLTNRELVLAALADGPSTLRAPLFSRDSELMIEGLRALGTTIERIPGRGDFGGDLRV
                     TPADELTGSTTIDCGLAGTVMRFLPPVAALALGPTTFDGDEYARKRPMAGVVHGLQAL
                     GVDLDDDGRGTLPFTVHGTGRVGGGPLEIDASASSQFVSALLLSAARFERGLDLRHTG
                     DRLPSMPHIEMTIASLAARGVAVASPERGRWVVSPGPIAAIDVDIEPDLSNAAPFLVA
                     AIVAGGSVTIGGWPATTTQVGAQLIELLPRFGASVRRDGDRLTVQAPARPAGGGRGIR
                     GVDLDLSEAGELAPNLVALAALADSPSTITGIEHIRHHETDRIAALATELNGLGGRVT
                     ELPDGLRLEPAPLHEGAWRAYADHRMATSGAIIGLAVPGVVVDDIGSTSKTLPQFTEL
                     WGKLLA"
     gene            401717..402340
                     /locus_tag="MTO99_01775"
     CDS             401717..402340
                     /locus_tag="MTO99_01775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013493348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0003700 - DNA-binding transcription factor
                     activity [Evidence IEA];
                     GO_function: GO:0016987 - sigma factor activity [Evidence
                     IEA];
                     GO_process: GO:0006352 - DNA-templated transcription,
                     initiation [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-templated [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="UOE46031.1"
                     /translation="MTADETGAAAPETERPLGELFEEQALPFLDQLYGAALRMTKNPA
                     DAQDLVQETFVKAYAAFGQFTQGTNLKAWLYRILTNTFINSYRKKQREPYQGTIDDLE
                     DWQLGGAESTTSSSSRSAEAEAIDHLPDSAVKDALQALPEDFRLAVYFADVEGFSYQE
                     IADMMHTPIGTVMSRLHRGRRLLRESLAEYAGSQGYDTAPKPTRSRK"
     gene            402337..402594
                     /gene="rsrA"
                     /locus_tag="MTO99_01780"
     CDS             402337..402594
                     /gene="rsrA"
                     /locus_tag="MTO99_01780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012299392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016989 - sigma factor antagonist activity
                     [Evidence IEA];
                     GO_process: GO:0045454 - cell redox homeostasis [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="mycothiol system anti-sigma-R factor"
                     /protein_id="UOE44549.1"
                     /translation="MTDCGCEKARQELEEYLHNELCREDAADIREHVANCPECSAELN
                     VGRTITEVVQRACRENAPGELRLAVLTRIREVQAHSAVVID"
     gene            complement(402769..406506)
                     /locus_tag="MTO99_01785"
     CDS             complement(402769..406506)
                     /locus_tag="MTO99_01785"
                     /EC_number="4.1.1.71"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016463352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004591 - oxoglutarate dehydrogenase
                     (succinyl-transferring) activity [Evidence IEA];
                     GO_function: GO:0016746 - acyltransferase activity
                     [Evidence IEA];
                     GO_function: GO:0030976 - thiamine pyrophosphate binding
                     [Evidence IEA];
                     GO_process: GO:0006099 - tricarboxylic acid cycle
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional oxoglutarate
                     decarboxylase/oxoglutarate dehydrogenase thiamine
                     pyrophosphate-binding subunit/dihydrolipoyllysine-residue
                     succinyltransferase subunit"
                     /protein_id="UOE44550.1"
                     /translation="MSSQLTGTGADETSSAEFGANEWLVDEMYQKYLVDRDSVDRTWW
                     PVLEQYRQTREAQAGQPAASPEASAPSAPEASAPSAADAAPAPAPVTAPAPVIGQAPA
                     ARTTSVAPRPEPVPADVPITSPQPVVADTDEAVDEVVPLRGMPKTLAANMDASLTVPT
                     ATSVRTVPAKLMIDNRIVINNHLRRTRGGKVSFTHLIGWALIQALKDFPSQNVAYAEI
                     DGKPSLVKPAHIGLGIAIDIPKPDGTRALLVPAIKRAETMTFNEYLAAYEDLVSRARQ
                     NKLKADDFQGATISLTNPGGIGTVHSVPRLMKGQGCIIGAGALEYPAEFQGASEKTLS
                     NLAIGKTITLTSTYDHRVIQGAGSGEFLKKVHELLIGERRFYEDIFAALRLPYEPIRW
                     APDISVDIASAIDKTARVQELINAFRVRGHMMADTDPLEYVQRSHPDLDIASHGLTFW
                     DLDREFVTGGFGATRTAKLRDILGVLRDSYCRTIGIEYMHIQDPVQRKWIQEQIERPY
                     EKPTHDEQMRILGKLNEAEAFETFLQTKYVGQKRFSLEGGESMIALLDEVLQGAAKAG
                     LDEVAIGMAHRGRLNVLTNIAGKTYGQVFREFEGTASAHGSGDVKYHLGTQGTFTADD
                     GQQVPVSLAANPSHLEAVDGVLEGIVRAKQDRKPIGSFSILPILVHGDAAMAGQGVVV
                     ETMQMSQLRGYRTGGTIHLVVNNQVGFTTVPGDARSSIYSTDVAKTIQAPIFHVNGDD
                     PEAVVRVAELAFRYRQEFKRDVVVDLVCYRRRGHNEGDDPSMTQPLMYNLIEAKRSVR
                     KLYTEALVGRGDITEAEYEEAHRDFQDRLERAFAETHAVQTGAIQVIGATDTDQSPEP
                     ATGELATTGVSVEVVHAIGDAFANKPAGFTVHPKIQQLLTKRQDMSRNGKIDWGFGEL
                     LALGSLLVEGTPVRFAGQDARRGTFVQRHAVLHDRVNGQEWLPLQNLSENQARFWIYD
                     SLLSEYAAMGFEYGYSVERADALVLWEAQFGDFGNGAQTIIDEFVSSAEQKWGQRSSV
                     VLLLPHGYEGQGPDHSSARIERYLQLCAENNMTVARPSTPASYFHLLRRQAYVRPRRP
                     LVVFTPKAMLRLRGATSEVADFTQGRFEPVIDDARITDKSAVKRALFMSGKIYYDLLA
                     ELDKHPNPEIALIRIEQLYPLPGDELKAIADSYENAELTWVQDEPENQGAWPYFIFET
                     NKLGPRPVSVVSRPAAASPATGSAKRHAAEQADIIQRALTL"
     gene            406685..408124
                     /locus_tag="MTO99_01790"
     CDS             406685..408124
                     /locus_tag="MTO99_01790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011186625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003938 - IMP dehydrogenase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="GuaB1 family IMP dehydrogenase-related protein"
                     /protein_id="UOE44551.1"
                     /translation="MEFYRTSPSHDLTYSDVFLVPSRSAVTSRLDVSLATSDGSGATI
                     PIVSANMNSVTGPRLAASLARRGGLGVLPQDLHLQDLADAIRWVKAQSPRFDTPFELS
                     PDATAADALVALPPVAGHGIVLRDDAGEYVGCIVAERLATALPDARLGDLVHSAMPSI
                     DAEDVASPRRAFDLMADAGLEFAPVLEHGRVVGTLSRRSALRGTVYEPNLDGQGRLRV
                     AAAIGINGDAAAKARALAEAGVDLLVIDTAHGHQDGMLRAIAAVADLDLGLPIAAGNI
                     VTADGVRDLVSAGAGILKVGVGPGAMCTTRMMTAVGRPQFSAVLEAADTARELGARVW
                     ADGGVRYPRDVALALAAGADAVMIGSWFAGTIEAPGTLRSDASGRLYKESWGMASTKA
                     VRERFDRLSAYELARRELFAEGISSSSIYLDPQRPSIEDLLDMITSGVRSSFTYAGAR
                     TLAEFRERALVGIQSAAGYEEGKALPVSW"
     gene            408237..409577
                     /locus_tag="MTO99_01795"
     CDS             408237..409577
                     /locus_tag="MTO99_01795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010205016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin family protein"
                     /protein_id="UOE44552.1"
                     /translation="MSEWILLGIGLLLTIGTGLFVASEFALVNLDRADLEARRERGET
                     RLGMTIAALKITSTHLSSAQLGITLTTLLTGYTMEPAISSLLAPSLAAVGVPDALVRP
                     IGATTAVVIATLLSMVLGELVPKNFALALPLATAKAVMPFQTAFSWVFRPAVAVLNGS
                     ANGILRAVGIEPKEELSGARSAEELSSLVRRSASAGLLEEDTATLLGRTLRFSEHDAG
                     DVMTPRPRLAAVQRLEPASAVLELARRTGYSRFPVYDENLDDMVGIVHVKQAVAVPRE
                     RRGDVPTSALQSEALRVPETMKLDTLLGELRGRGFQMAVVVDEYGGTAGVATLEDLVE
                     ELVGEVADEHDRTRAGIVRRGDVVSFPGILRPDELLERTGIRVPENGDYETVAGFVMA
                     ELGALPVVGDEVSIEQGTLRVQRLDGRRIDRLRFEPTAEPVADRVDDVHEEGRR"
     gene            409574..410611
                     /locus_tag="MTO99_01800"
     CDS             409574..410611
                     /locus_tag="MTO99_01800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005048345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin family protein"
                     /protein_id="UOE44553.1"
                     /translation="MSDWAGLAWLVVLLIGNAFFVGAEFAVISARRSQIEPLAEQGRR
                     SAKTALWAMEHATLMLAMSQLGITICSLLILNVSEPAIHHLLEAPLHLTGWSEDAVGT
                     IAFVITLVLVSYLHVVFGEMVPKNLSFSVPDRAVLLLAPPLVFLARVFRPVIVALNAT
                     ANGVLRLFRVEPKSEATSTFTLEEVQTIVDQSRREGVLEDASGTLTAAFEFTSKCVRD
                     VAVPASGLVSLPSDATPADVERAVARHGFSRYVLLDADGEPHGYVHLKDVIDLDDDEF
                     DDPIPAKRVRRLVSIFDGTDLEDALATLRRLGTHVARAFDEAGETTGVIFLEDIIEEL
                     VGEVQDATRRG"
     gene            410688..411122
                     /locus_tag="MTO99_01805"
     CDS             410688..411122
                     /locus_tag="MTO99_01805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018773921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="UOE44554.1"
                     /translation="MFEKLMATAVLPAADLDRAKQWWHDVLGRDPVWSEDEGEIAFYD
                     IGGTVVLVYRTDYAGTARNTALNLMTDDLDRDMTALRTRGVVFHDYDLPGVTTVDGVA
                     ETGEERTAWFSDSEGNIIALGQPSAQMRELATKLRSSSAGTG"
     gene            complement(411135..412220)
                     /locus_tag="MTO99_01810"
     CDS             complement(411135..412220)
                     /locus_tag="MTO99_01810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018172015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase/NADH oxidase"
                     /protein_id="UOE46032.1"
                     /translation="MFRPITIRDLEIRNRIWVPPLCQYSVTARDGVPTDWQLVHLGSF
                     AAGGAGLVIAEATAVNPVGRISDYDTGIWNDEQVAAWRRITRFIRSQGAASGIQLAHA
                     GRKASVWPEPLRRPGSQPLDAGGWPTVSASPIAFEGYRAPVALDEAGIRATIDDFRQA
                     ARRAVAAEFDLVEVHAAHGYLLHQFLSPLSNRRDDAWGGDLAGRARLLLEIVRAVRAE
                     IGERMPLFVRFSATDWVDGGWDEAQTATVARWAQEAGADFFDISTGGLVADAHIPTGP
                     GYQVPHAERVRDAGGVAVSAVGRITSPAHAEELVASGRVDAVMFGKAMMRDPHFAMRA
                     AHELGADTSMWPVPYLRARPAVNDGEW"
     gene            complement(412283..412918)
                     /locus_tag="MTO99_01815"
     CDS             complement(412283..412918)
                     /locus_tag="MTO99_01815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family phosphatase"
                     /protein_id="UOE44555.1"
                     /translation="MPWPHLAPISLAPRVVVFDYGEVISREPSTADRAVLLERAGAES
                     EPFWAAYWAHREGLDQGTQSIAEYWAAVGRDLGRDYSPIDVHELWAIDHRSWLSVDPA
                     TLAVLHALRAGGTRLGLLSNAGADFAGWLRFGSFAPLFERVFISGELGLVKPGREIYE
                     HVIADLGIEASDLVFIDNKAENVEGAKAIGGDGHVFTDAAALEAWLRGVAS"
     gene            412942..413796
                     /locus_tag="MTO99_01820"
     CDS             412942..413796
                     /locus_tag="MTO99_01820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010205019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-hydrate dehydratase"
                     /protein_id="UOE44556.1"
                     /translation="MEPNGWREWTAADAAEWIVEPGPDDDKYARGVLGVITGSLDYPG
                     AAVLGVEAASRAGVGMVRYIGPRRVAAAVLLRRPETVRVAGRVQAWLLGSGMDATRRS
                     FVLAGELQHALASGVPIVLDAGALDLVGSHTGPTIVTPHARELANLLASRDLRSSVEE
                     VRADPAGWAVRAARELGTAVLLKGAVTRICDPEGSRFTVTAATHRLATAGTGDVLGGI
                     LGALVATNHARFAHDRSALAKIAASAAWVHAEAGRRASEAVDGGPVTAMDVAGAVPAV
                     VGGLARRH"
     gene            complement(413799..414539)
                     /locus_tag="MTO99_01825"
     CDS             complement(413799..414539)
                     /locus_tag="MTO99_01825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018171775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="UOE44557.1"
                     /translation="MTESVLHLTGIRKSFGDSEVLRGIDLEVAAHEVVALIGASGSGK
                     STLLRTVNLLERIDDGVIRLRGEDISDPRVNADRVRARIGAVFQHYNLFPHLSVIDNV
                     TLAARLVHRMPRADAERRGRELLASIGLAEFAGAYPDRLSGGQQQRVAIVRAIMTEPE
                     LLLLDEVTSALDPELVGEVLALVRSLADGGTTILMATHEMAFARDVADRVVFLDGGRI
                     AEHGPAHEVFTAPREPRTREFLARMLHG"
     gene            complement(414536..415414)
                     /locus_tag="MTO99_01830"
     CDS             complement(414536..415414)
                     /locus_tag="MTO99_01830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018188840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="UOE44558.1"
                     /translation="MTAATTDPPHGSSAGPSEVEFARRAYRRRQTGRSVLISAASTLV
                     FAVVVIGAVLLSPGWSRVQQTFFDWDVAVASFPRIIAGLWLNLQVLVFAAVGVALVGL
                     LLATLRTLRGPVFFPLRALATGYTDLFRGVPLIIMLYLIGFGVPALEFFPRVPVAVWG
                     TVAIVIVYSAYVSEVLRAGFEAVHPSQRLAARALGLTHGQTMRRVVVPQALRKVTPAL
                     MNDFVAMQKDVGLISVLGAVDAVRGAQIEVAHFFNYTPYVVAGLLFVLLAWPTIRLTD
                     WLSARMRDREQVGSLV"
     gene            complement(415479..416312)
                     /locus_tag="MTO99_01835"
     CDS             complement(415479..416312)
                     /locus_tag="MTO99_01835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018171777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="UOE44559.1"
                     /translation="MSRRPLLVLAVAAAAALALTGCTAGGDSADTGSGGDFVTEGKFT
                     VGTGEPAYFPWVIDDTPESGEGFESAVAFAVAEQLGFAKEDVVWVRTTFDQAIAPGPK
                     DFDINLQQFSITPERAEAVDFSSPYYETTQVVITVEGSPAAGATSIADLKPLLIGAQT
                     GTTSFDAIEQAIAPDQGAQVFNTNDDAKLALQSGTVDAIVVDLPTAFYLTGAELDGGL
                     IIGQLPTAGAGDEFGLVLAKGSPLTERVTAAVDALREDGTLDALAEQWLGSDDTAPVP
                     R"
     gene            416439..417701
                     /locus_tag="MTO99_01840"
     CDS             416439..417701
                     /locus_tag="MTO99_01840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017831075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44560.1"
                     /translation="MTVGAARRALGGRAALWIAFAVAHLLVALLGLWGFGWPLGDLAT
                     YRAWAQEADFGAVRMGIDVPWVYPILAFAPMAAALALGHEWYDQAWLAIVTGLDAIAF
                     AILLGRGVLTRGRRAAAWWWMGFAVLLGPVALGRIDAVTVPFAVVGLLVALGRPRVAA
                     TLLTVGAWIKVWPAALIGALMVAVRRRAEVAVIAVALSAGVLGVSLLAGSGLNALGFI
                     GEQTGRGLQVESPGAVPFLWMIAAGDATHRVYYDRDILTYQLLGPGTADVAWWSTPAL
                     VVAVAAVVVVGVRAVRRGASAGRLLAPLSLAFVTVLVLANKVGSPQFATWLIAPVVLQ
                     TVLDRRRALVPALAGLGVALSTHLVYPYLYGWLLIADPALVLVLTLKVALLMLLLAWA
                     VRAVWQAGSAPGRRADRPVGAGRSAGEE"
     gene            417701..418009
                     /locus_tag="MTO99_01845"
     CDS             417701..418009
                     /locus_tag="MTO99_01845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-binding protein"
                     /protein_id="UOE44561.1"
                     /translation="MLVAFSVAPSGTGRADGSVHDAVAAAVKIVRESGLPNRTTSMFT
                     EIEGEWDEVFDVVRRATEAVGEYGSRVSLVLKADIRPGYSGELDAKVERLERAIDAGD
                     "
     gene            418067..419341
                     /locus_tag="MTO99_01850"
     CDS             418067..419341
                     /locus_tag="MTO99_01850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="UOE44562.1"
                     /translation="MTHSDDGQATLSPARIRFALLALALGGFGIGSTEFVAMGLLPDI
                     AADLLPGVHASSPEHANAQAGWLISAYALGVVVGAPTIAAAAARWPRRRLLLALLTAF
                     TLGTVASALLPTFGLVLVARFVAALPHGAYFGIASLVAASLMGPGKRGQGVALVLSGL
                     TIANVVGVPAITWLGQVTDWRIAYLAVAGIFAATFLAVLVAVPWQPGDPDATIARELR
                     AFSRLQVWFALAIGAIGFGGLFAVYTYVAPLATEVTGLDAAAVPVVLVVIGLGMTVGN
                     LIGGRLADWSVRRSMYLFFAVLAAALVLLGFAATTVVGLGAGVFLVGASSAALSPTIQ
                     TRLMDVARDSQSIAAALNHSALNIGNSLGAALGGAAIAAGFGYVAPVWIGLALTGAGI
                     VLALASFALDRARRRRGVDVPGVTAAIAVVEG"
     gene            complement(419425..420072)
                     /locus_tag="MTO99_01855"
     CDS             complement(419425..420072)
                     /locus_tag="MTO99_01855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017888182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="UOE44563.1"
                     /translation="MPSPAPIRLAIVDDHRMLLGALSEWLRTAATDITVAAAVPSWSE
                     LLASPEFPVDVVLLDLDLKDNIPVQIKLPTLKAAGAQTLLISTYSEPEQVRGALAAGA
                     LGYLPKSEPVETIVEAIRAAHSGDLFLTPEVEATLADGAQSPKLSAQERRVMALYGAG
                     QPVKAVAFQLGISEETAKSYLKRIREKYRVAGYDVGTKVALRKRAIADGILLQTD"
     gene            complement(420073..421332)
                     /locus_tag="MTO99_01860"
     CDS             complement(420073..421332)
                     /locus_tag="MTO99_01860"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44564.1"
                     /translation="MTAAFDETAARPGRERGFRRPARSAEAAGNVHAGHGGRRLATGI
                     AVAAGFLAAGHLVHALIQAPVFPPGTGSWPAWILLATLGVAAAIAVVASGFAVPTWLL
                     AGALVGLAAVVALDVSATAGRLHLGITPTAAVAAAAALLPIAAMRRTRTPLVAACAVG
                     VVLAVEALWQPDAGRALVLGLAIAASAVLPMVLGVTAIEGFRRLVRREVDLSLVQSTV
                     TTPESAVGMRASEELVNLDRDAEDLLEDVGSGRVAIPLPPEASELAGELAARLRVRLI
                     EGRTDTWLRHAVTESAYLSGHVTVDDPTGLAAQLTATQREGLLLVLWMLVGARPRRAT
                     ARVVVQITADDGDDDPRPEGLRVVVTVSDVQPRHLDPAIWEAVGTVGSHRTFAASDGF
                     GIEIDGRIEPHHRVPNAPPQGARHRGA"
     gene            complement(421329..422486)
                     /locus_tag="MTO99_01865"
     CDS             complement(421329..422486)
                     /locus_tag="MTO99_01865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015490021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="UOE44565.1"
                     /translation="MKRILKERDRLLRRVARVAGITGAAGALAGLVVPGTAPVPAQIA
                     GAGLLVALGGLLVFATRRGGVVPLLGVVVVALMTVVLIAPDRTADPIASTVAAAVGGV
                     AAASTAIMLIVRPHGGWIVAGALAGVLAVYGVLALVGRPTGAAVLAVAVGWLAAASLG
                     RWLDLAIERTAERIEEVGRAHQAERMASELAAQRRQDARVLHDTVLATLSLLAHSGVG
                     VGTAALRQQASDDARLLRMLRLGAPLDAGTSAVFSPDAEVGSLSTTFESVRQRFSRMG
                     LDVSWHGTGQLALPRDTLDALVGALGECLENVRRHSGVTEADVTVTDDDRTVRAMVTD
                     SGAGFEPGSVDRARLGFAESVVGRLDAVGGRARVFSSPGTGTTVMLEVPKP"
     gene            complement(422601..423806)
                     /locus_tag="MTO99_01870"
     CDS             complement(422601..423806)
                     /locus_tag="MTO99_01870"
                     /EC_number="2.3.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018188685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016747 - acyltransferase activity,
                     transferring groups other than amino-acyl groups [Evidence
                     IEA];
                     GO_process: GO:0009058 - biosynthetic process [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-acetyltransferase"
                     /protein_id="UOE44566.1"
                     /translation="MDWQSTAETAPARVIPDFPATQLPGRAPATGAWRVGDHPGDRRF
                     VRIGEVALESGGVVPDAVIAYETWGELSPARDNAVLVLHALTGDSHVRGPAGPGHASA
                     GWWGGVVGPGLAVDTDRWFVVAPNVLGGCQGSTGPASLAADGVEWGSRFPFLTIRDQV
                     AAQLAFATAIGVDRFAAVVGGSMGAMHVLEWAIMAPDRVERIAVLAAPAAATADQIAL
                     NSVQLEAIRADAAFEGGDYYDLPHGEGPTRGLALARRMAMLNYRSAAELNARFERSWQ
                     SGLDPLGGGGRFAVESYLDFHGNRFTRRFDANSYLVLTEAMNSHDVGRGRGGVAAALG
                     RIRAKTLVLGIDSDRYFGLDGQREIAAHVPTLVHGSEPVLLSSEYGHDAFLIEDAFVG
                     EQIARLLAA"
     gene            complement(424096..425421)
                     /locus_tag="MTO99_01875"
     CDS             complement(424096..425421)
                     /locus_tag="MTO99_01875"
                     /EC_number="2.5.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005048360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016765 - transferase activity,
                     transferring alkyl or aryl (other than methyl) groups
                     [Evidence IEA];
                     GO_process: GO:0019346 - transsulfuration [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional o-acetylhomoserine/o-acetylserine
                     sulfhydrylase"
                     /protein_id="UOE44567.1"
                     /translation="MSRNPADWQFETKQVHSGAAPDPVTKARATPIYQTTSYVFDNAE
                     HAQNLFALAEFGNIYTRIQNPTQAVVEERIAALEGGTGALLLASGQAASTFAVLNIAQ
                     AGDHIVSSSSIYGGTYNLFKYTLAKLGIETTFVENQDDADEWRRAIRPNTKLFFAETI
                     GNPKINVLDIRGVADIAHEANIPLIVDNTIATPYLIRPFEHGADIVVHSATKFLGGHG
                     TTIGGVIVDGGTFEWSKHVDKFPGLTEPDPSYHGASYTTAVGDGLAYIIKARVQLLRD
                     LGSAISPNSAWLLIQGIETLSLRVERHVQNAQEIAEWLDSHADVASVNYSGLPSSPWY
                     AAANTYAPKGVGAVLSFELKGGVDAGRALVDNLHLFSHLANIGDVRSLVIHPASTTHS
                     QLTPEQQLTTGVTPGLVRLSVGIENIDDLKADLEQAFAAARAATEAARV"
     gene            complement(425577..426680)
                     /locus_tag="MTO99_01880"
     CDS             complement(425577..426680)
                     /locus_tag="MTO99_01880"
                     /inference="COORDINATES: protein motif:HMM:NF013884.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0016747 - acyltransferase activity,
                     transferring groups other than amino-acyl groups [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase family protein"
                     /protein_id="UOE44568.1"
                     /translation="MHHPAPTARPMPKRRVPLWDNARWIAITLVVIGHGILPLIGEDD
                     AAYSAYLFIYSFHVAVFVTVSGYFAKSGPPTARALKQILTEIVFPYLIFETIWTVIRW
                     VLGGEFALDFTTASWTLWFLIALAIWRIVLPYLVLLRWPLPIAILISIGAGYTETIDS
                     TLALSRTFGMLPFFVFGWQLRQWRITGRWLALSTAAAWRWRAGAIALFAVLLAVMPAA
                     IETWRDLKLRRFMLYDESYVAIGYEEPWSGLIRLGLLLLAMVLAVAFLVLMPRGHRWF
                     TAFGGATMYIYLLHSFVLYPLRETELLAGQQPWWVLPAMIVFCIGVSIVLSLKPVRRV
                     FRPLVQPRARWLFRPAPATPTGTIVLPHDDRPN"
     gene            426744..427532
                     /locus_tag="MTO99_01885"
     CDS             426744..427532
                     /locus_tag="MTO99_01885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017831067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="UOE44569.1"
                     /translation="MTQLRAVVTGASSGIGAATVRAFRAAGWEVVAVARREERLRVLA
                     AETGASVVVADVTDQGDVDALRDRLREIGPIHALVNNAGGAKGLDSVEASDPEDWRWM
                     FEVNVLGTKRVIGALLPLLREGAVERGVADIVNLTSIAGHVAYVGGGGYNAAKFAEHA
                     LTAVLRLELNGEPIRVIEVAPGMVKTDEFALVRFGGDRERADAVYSDVPEPLVAEDIA
                     EIIVDAATKPRHVDLDLIVVKPVAQSAPHLVAKGPLTVRSAGRA"
     gene            427529..428257
                     /locus_tag="MTO99_01890"
     CDS             427529..428257
                     /locus_tag="MTO99_01890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012298816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="Type 1 glutamine amidotransferase-like
                     domain-containing protein"
                     /protein_id="UOE44570.1"
                     /translation="MSVHLVGGGTFEPTDATAPIWAGFRDEAAAHAARAGREVPRIAV
                     ITARSGDPAAQAVKIVALLEGAGPVEARTTVVLAAEAAVSAAALADVDGVVVGGGHAP
                     SYRAAVEPVFGELRRQVAAGVPYLGFSAGAMIAAERAIIGGRRIGGVVVSPEPGDQEL
                     DEVTIAPGIGLVDVAIEVHVAQWGALSRLVAAVEAGLVEGGLGIDEDTALVVGDGGLR
                     VVGAGSVWRVLPGEQGVVVATMGA"
     gene            428261..428953
                     /locus_tag="MTO99_01895"
     CDS             428261..428953
                     /locus_tag="MTO99_01895"
                     /EC_number="3.2.2.27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011186606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004844 - uracil DNA N-glycosylase
                     activity [Evidence IEA];
                     GO_process: GO:0006284 - base-excision repair [Evidence
                     IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="UOE44571.1"
                     /translation="MPKTLPELAEAGLMDPGWADALAPVAGDIARMGDFLRAETAAGR
                     GYLPAGDHVLRAFAAPFSDVRVLIVGQDPYPTPGHPIGLSFAVEQHVRPIPRSLQNIY
                     RELADDLGVHPPAHGDLSAWTRNGVMLLNRVLTVRPGAPASHRGAGWEAVTDHAIRAL
                     VARGTPMVAILWGRDAQSLKPLLDGTPAIESVHPSPLSASRGFFGSRPFSRANALLAQ
                     RGGRPVDWSLEP"
     gene            429026..429604
                     /locus_tag="MTO99_01900"
     CDS             429026..429604
                     /locus_tag="MTO99_01900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011186605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase family protein"
                     /protein_id="UOE44572.1"
                     /translation="MLEEEYQERRVLPPHLRAPEPAERPFAFAIRDAVAADLPSVREI
                     YNYYVANSTVTFDEDAMTLREWKQKFAYLHKLGMPFLVAESPTGQLLGYALVQPWKQK
                     RAYRFTVENSIYLGPAASGKGLGKALLAELIARSKAAGLKEMIAVIADQGAEASIGLH
                     EKFGFTEIGRMGKVGFKFDRWLGTVLMQRSLK"
     gene            429703..431094
                     /locus_tag="MTO99_01905"
     CDS             429703..431094
                     /locus_tag="MTO99_01905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="UOE46033.1"
                     /translation="MHTALQRGRLSPTEVAEWFLERIDRLGDDVGAFAEITPERALER
                     ARHVEREVPKAAPLWGMPLADKDLHSRAGVPTRFGSRAFADHVPDESDDLVLDLDRAG
                     AVSLGKTATPEFGLPSYTEPVGAPPARSPWDARLGAGGSSGGAAAAVAAGLLPFATGS
                     DGGGSVRIPAASCGLVGVKPSRGRVPSGSGLGGLAGLSVVGPLARTVADAALLLDGVM
                     APAGYPVQHRFAVRAPGSDGPYLGDALCGEGRFQIGVLTDSPWDDAYDIEIAPESRDA
                     LAHAVTLLDRLGHGVDELVRAPEPGYPAAFRTIWQASAATIPLEGEALGLVEPLTAWL
                     VDRGRALGARDLADALAWLAGFERRTIGRFAAYDAVLTPALALTPRPVGWYDAADGER
                     NFAQQVQFTPFTSFVNVAGLPAISLPVHTTATGFPMSVQLIGRPGGEATLFALAAQLE
                     RVARLAGRRPPVW"
     gene            431222..432160
                     /locus_tag="MTO99_01910"
     CDS             431222..432160
                     /locus_tag="MTO99_01910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012037815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore-interacting protein"
                     /protein_id="UOE44573.1"
                     /translation="MLTSLAVGTEVRPAYRSYRVAVRRAERIAPSFVRVTFTGDELGL
                     FGTAGLDQRVKVVLPLPDDLVATGDGFASFPTGDDWYTRWRELPEARRNTFRTYTVRA
                     VRPAEREVDVDFVLHGETGPASRWVSRAQPGDEAVLIGPDERSTGRALGIDWRPGEVE
                     TVLMAGDETAAPAICAILEALPRDARGCAFIEVPSEGDVLDVDAPDGVSVRWLPRGEH
                     AAHGDRLVPAVRDGAARIMSAPGEVVDLDDVDVDAELLWDVPEGRSLDGGVYAWVAGE
                     ASVVKSIRRYLVSEAGLDRRRVAFMGYWRLGRSELD"
     gene            432165..433220
                     /locus_tag="MTO99_01915"
     CDS             432165..433220
                     /locus_tag="MTO99_01915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018191595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="UOE44574.1"
                     /translation="MSRTLDPVSAPGAAAAPGRARRTPRAARRLLAVALSLVVLVAAV
                     WASLAFGVRAIDPGAVWQALVAPVEGDRAHEIVLELRVPRTVIGLLAGVAFALAGALI
                     QGVTRNPIADPGLLGINSGAAFAVVLAIQLLGLTEPAAYVWFAFAGAAAAAAAVFAIG
                     AARPDRLALVGAAMTALITPLTTLVLLGDIETFDQYRFWVVGSLTGRGLSTAAVLWPF
                     VVVGAVLAIALAHRINGLALGDDVARGLGQRVGTTRAVAAVAIVVLAGTGAALAGPIA
                     LVGLVVPHAARRLVGSDARWVIACSIVLGPAMLLIADVVGRLVGAPGELEAGVVAAVI
                     GAPVLIAVARSRSVVGV"
     gene            433222..434337
                     /locus_tag="MTO99_01920"
     CDS             433222..434337
                     /locus_tag="MTO99_01920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012878933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="UOE44575.1"
                     /translation="MTAPIAPAPRSTRPSGGAPGAISDAARPGASETLATIAAVRRAR
                     RRRVSWVLAGCLALLLAVGAIALVLGAADVSADRVFLALIGLGDEGDRFVVMRLRVPR
                     ILAAIVCGVAFALAGAVFQAVLRNPLASPDILGISGGASLGAVWALLVLGLGGAAVSG
                     IAFVAALAVAVAIWALAWRQGLHGIRFVLVGVGFAYVTGSLVAWLLTRAEVRQAQSAL
                     AWTVGSVADVRGDELGWLAAAVAVGCIVVAALARRLGVLALGDDHARGLGVAADRTRI
                     VLLLVAVALVALATAAAGPIAFVALVAPAIARALTGGGAALAASAATGAALTLTADVI
                     GQYALPGIVAPVGIVTGVIGAPYLLWLLATTERRRRA"
     gene            434334..435182
                     /locus_tag="MTO99_01925"
     CDS             434334..435182
                     /locus_tag="MTO99_01925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020013971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="UOE44576.1"
                     /translation="MNANAESSAPASDGDRTLRAHAVSIGYDGRRVIEGLDLEIPEGR
                     VTVIVGPNACGKSTLLRGLAGLHPLEAGRVTVGGADARSLGRRRFAKLVGVLPQTSVA
                     PDGVRVAELVARGRFPHQGWFGRHSSDDDAVVAEALAATGIADLADRRLEELSGGQRQ
                     RVWIAMVLAQQTDIVLLDEPTTYLDLTHQIELLDLLRTLNRERGTTVVMVLHELNLAA
                     RYADRMVVMCEGRVVAEGAPAEVITDRTVADAFGLEAQIVVDPVSGSPLVVPVGPIAA
                     QRGVPA"
     gene            complement(435214..436083)
                     /locus_tag="MTO99_01930"
     CDS             complement(435214..436083)
                     /locus_tag="MTO99_01930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012300190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="UOE44577.1"
                     /translation="MSSTLVLPGGTWTLGDRTVTRFGYGAMQLAGPWVMGPPKDRDEA
                     LAVLREAANSGITHIDTAETYGPRVVNDLIREALHPYAADLLIATKVGGRRDAQGGWP
                     AARTPDELRRQIDDNLETLGLDALDLVHLRLGDASGTVPEDIEEAFGTLVDLQRQGVI
                     RHLGVSNATAEQVAQAQSIAQIVSVQNRYNLANRGDDDLIDRLAAKGIAYIPFFPLGG
                     FSPLQSDALSGVATRLGSTPLSVALAWLLHRSPNILLIPGTSSTAHLRENIAGSRLTL
                     VEEDLRELDGIAG"
     gene            436197..436616
                     /locus_tag="MTO99_01935"
     CDS             436197..436616
                     /locus_tag="MTO99_01935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005885516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="UOE44578.1"
                     /translation="MTTTTAADRRAHAKTQYNAFLAACPSQRLLARISGKWVALVLSA
                     LGSGPDCDGEPRPLRNSELARILAGVSPKMLSQTLRSLERDGLVTRTVTPTVPVTVSY
                     ELTDLGLSLHRTVRELKRWAEANRDAVTANQQRYDGA"
     gene            436715..437764
                     /locus_tag="MTO99_01940"
     CDS             436715..437764
                     /locus_tag="MTO99_01940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012878935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="UOE44579.1"
                     /translation="MRLRRSLTAIAGLAAAATLLTACAGTASGDDAAAPESGGFTTTE
                     ATDEFPLVIEHAFGETEVAEAPERVATWGWGSTEAAISVGVYPVAVAEQSWTVGEGNL
                     LPWVEEAYDEAGIPKPAVLTDADGGATMPYEEFVAADPDLIVAPYSGLTEEQYDLLSD
                     IAPVVAYPDAPWTTSWQDTISITANSLGRSAAGDQVLRDIEQGIADDAAAHPEFEGAT
                     FVSIWDGDGVVSVYTEADARVSVLTGLGLEVAPSVAELDSSDGGFYYDLSYEQVDQLD
                     ADFVILFAASEDAAAASLAKPELQAIPAVAAGKVVQVVDPVTVSSVSPPTALSFGWQA
                     GWPTLVADIASVLAG"
     gene            complement(437778..438191)
                     /locus_tag="MTO99_01945"
     CDS             complement(437778..438191)
                     /locus_tag="MTO99_01945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017203191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="UOE44580.1"
                     /translation="MNRTVRVRPLDSWISRVGYWWATAVGFVWGFVWSTGRIEVRHGL
                     IVFTGMPKWTFGRGGACVGRCYLTDRNTGERVLGHEAVHRRQWQRYGMLFPLLYLAAG
                     RDPLRNRFEIEAGLEAGGYVRADGTPRVPARPRRR"
     gene            complement(438188..439672)
                     /locus_tag="MTO99_01950"
     CDS             complement(438188..439672)
                     /locus_tag="MTO99_01950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018172727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="UOE44581.1"
                     /translation="MVREVDVVVIGAGPVGENVADRAKAGGLDVVIVERELVGGECSY
                     WACVPSKTLLRSAAALRAAQRVPGAAEAVTGELDVAAVLRRRNEWVSDWSDAGGEEWL
                     RGAGIGLERGHARLAGLRRVVVEHADGSTTELAARHAVVIATGTDAAVPDLPGLADAR
                     PWTSREATSAQTAPARLAIIGGGVVAVEMATAYAGFGSEVTVLARSSLLGGMEPFAGE
                     AAADGLRGLGASVHLGARLVSAARDDRDQVVIEVEGGEPVVADEVLVATGRAPRTADL
                     GLDTVGLAPGDWIEVDDTLLVAGEPAGEAGWLYAVGDVNRRALLTHQGKYQARAAGDV
                     IAARAAGGLVDDADWGVHVATADHAAVPQVVFAEPECASVGLTEAAAERAGRRTRVLD
                     VPLGSASGSGIHGDGPGGRARLVVDRDRETVIGATFVGPDIAELLHAATIAIVGEVPI
                     RRLWHAVPAFPTVSEIWLRLLEALGRPDAPGDRGASAPDEGAAA"
     gene            complement(439793..440647)
                     /locus_tag="MTO99_01955"
     CDS             complement(439793..440647)
                     /locus_tag="MTO99_01955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginase family protein"
                     /protein_id="UOE44582.1"
                     /translation="MPARFIVVPVWQGGGSARAMSHADGASAIQGDLPASATIAVEVP
                     VEAGEALGTGVRRYSSLRRVRERTEAALAGVTGLAITIGGDCAAAVAAVAHAARSGDG
                     PLAVLWLDAHPDLHTPETSPSGNFGGMALRAVTGEGADGLALGPDERVEPGRIVLGGA
                     RSIDDEERRFIDEHGIAALTVGQLGDPATVIAALEATGAARVFVHVDLDVLDPSALAG
                     LSYPLPFGVDTPELVALLRAVTGRFPLAGAAIAGFAPGSPAAAGDDLPAILRIVGALS
                     SAPQATTG"
     gene            complement(440655..441392)
                     /locus_tag="MTO99_01960"
     CDS             complement(440655..441392)
                     /locus_tag="MTO99_01960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017203190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PspA/IM30 family protein"
                     /protein_id="UOE44583.1"
                     /translation="MAKQSIFGRISQLVRANVNALIDQAEDPQKMLDQMVRDYTNSIA
                     DAEAAIAETIGNLRLLEDDHREDVDAAAEWGQKAVAASRKADELRAAGNTVDADKFDN
                     LAKVALGRQIDAEREAKAAEPQIASQTEVVDKLKAGLNGMKEKLEQLKSKRSELIARA
                     KTAQAQQQVHDAVKSVDILDPTSEISRFEDKIRREEAKARGQAELAASSLDAQFNELD
                     DLGELTEVDARLAELKAGNAGQSAIGG"
     gene            complement(443099..443449)
                     /locus_tag="MTO99_01965"
                     /pseudo
     CDS             complement(443099..443449)
                     /locus_tag="MTO99_01965"
                     /inference="COORDINATES: protein motif:HMM:NF016424.2"
                     /note="incomplete; partial on complete genome; missing
                     C-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="TPM domain-containing protein"
     gene            complement(443616..444395)
                     /locus_tag="MTO99_01970"
     CDS             complement(443616..444395)
                     /locus_tag="MTO99_01970"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44584.1"
                     /translation="MSDPDDRIGEALRHDADRSAPRPIDLDAVLAGSRAARRRRRRTI
                     VGGSVTAVALVAIVGIAMGPPLGFGTASISDAPASETATGEAATDASGDRGDDAAPDA
                     VAPQDGPEPGDVALGTLEQATACGRPAPQAASVDGLELVVTSAVLDAEGVGEVTAELS
                     TALGAARTVRISGAPSAMVAADGSVVWLASGAGVEEVVLRPGSPAVISVPVQAADCTA
                     GDEPLAPGAYDVVVVVDVAIDGRVNPVRLVSAAVPVAWAGN"
     gene            complement(444382..444912)
                     /locus_tag="MTO99_01975"
     CDS             complement(444382..444912)
                     /locus_tag="MTO99_01975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012725675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="UOE44585.1"
                     /translation="MSGTWDAIATTLVAERGDALNRYAYLLTGSADDAADLVQEALVR
                     TFGRPRMSLTLPRAEAYVRRAILNLVIDRSRRDGRWRDVRHLVAEPDRADAPDRAVDD
                     RIDVAARVRALSPRQAACVVLRYYDDLPVEQIARTLGISSGAVKRYLSDALRSLSAQF
                     DAADGGTPTGGDHVRS"
     gene            complement(445064..445136)
                     /locus_tag="MTO99_01980"
     tRNA            complement(445064..445136)
                     /locus_tag="MTO99_01980"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(445101..445103),aa:Arg,seq:ccg)
     gene            complement(445183..445812)
                     /locus_tag="MTO99_01985"
     CDS             complement(445183..445812)
                     /locus_tag="MTO99_01985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="UOE44586.1"
                     /translation="MFRSARRRLRPPLVVAAAAGAAMLLAGCTPASPTPTGSASATEH
                     PTETTPATGDPTPGETTAPEETSPPFAIGCDELLTPDQVYAFNPNFGAAPGYEPASAG
                     IRAVVDAGGTACGWLNQTSGELIEVAVATPSATAIAAAANGAASRLQAVPTYGTPPDV
                     EGYFGRSGQAGSAQVFSGRYWVVVESDALFEPGDATALVGSVLGNLPAA"
     gene            445877..447550
                     /gene="argS"
                     /locus_tag="MTO99_01990"
     CDS             445877..447550
                     /gene="argS"
                     /locus_tag="MTO99_01990"
                     /EC_number="6.1.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005048589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_function: GO:0004814 - arginine-tRNA ligase activity
                     [Evidence IEA];
                     GO_process: GO:0006420 - arginyl-tRNA aminoacylation
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="arginine--tRNA ligase"
                     /protein_id="UOE44587.1"
                     /translation="MTPADLSRALFDLVTASAERRRASGASVSLELAPDQIVLERPKL
                     REHGDWASSIALRIAKQFGTNPRELAGELAEGLAAVEGVASAEVAGPGFINIRLDAAA
                     AGALAKTIVEAGDAYGHGTTQAGRHINLEFVSANPTGPLHIGHTRWAALGDAMSRVLR
                     AAGAEVANEYYINDAGTQMDNFGASVLAAAKGEPTPENGYPGQYVADLAQRVLEREPH
                     LLEFPDEVALHTAKEIAYELQLAEIRASLERFNVHFDVWTSERRLQQRGDDGLSDVDT
                     AVERLRTQGHVFDADGAVWVRTTDFGDDKDRVIRRSNGEYTYFAADAAYYLDKSDRGF
                     THKIYLLGADHHGYVHRLKALAGAAGDDPERDIEVLIGQLVSINGAKLSKRAGNIIEL
                     DDLQAWLGTDALRYTLARYPADSPIAIDPEILQRRTNDNPVFYVQYAHARTAAVDRNA
                     ASVGVDRSSFAPELLEHETESALLGALQEFPRIVAQAAELLEPHRVARYIEELAGLYH
                     RWYDNCRVLPLGDEPIGDLQRTRLWLNDATGQVIRNGLDLLGVSAPERM"
     gene            447555..448376
                     /locus_tag="MTO99_01995"
     CDS             447555..448376
                     /locus_tag="MTO99_01995"
                     /inference="COORDINATES: protein motif:HMM:NF022655.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2993 domain-containing protein"
                     /protein_id="UOE44588.1"
                     /translation="MAATSDPNAGAADTAVIPDGWGEPSPKRPRRGARAVIVAAVVVV
                     VIAVLLAAADAFARSATEAQLAETIERRLPATVQGDVRAQVGGASVLWQLVTGTATEV
                     ALTSEGLTVQGAPVGVEVVARGVPLRGEGVIDTVDATLTLDEDSLNALVRAQHAPGGF
                     SLGDGTVGYRGTLDVFGVTVSYEATARAEAAGDRVLLTPVGVEIGAGGVSVDAGDLVS
                     RLLGGDPLEVCVADRLPEGAKLTSVQVTPERVRIEASAADVPMAAESLERTGDCG"
     gene            448599..449951
                     /gene="lysA"
                     /locus_tag="MTO99_02000"
     CDS             448599..449951
                     /gene="lysA"
                     /locus_tag="MTO99_02000"
                     /EC_number="4.1.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008836 - diaminopimelate decarboxylase
                     activity [Evidence IEA];
                     GO_process: GO:0009089 - lysine biosynthetic process via
                     diaminopimelate [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="UOE46034.1"
                     /translation="MWPAGAHRDAAGRLVIGGVDATALAERFGTPLYVVDESVVRGRA
                     ARIRAAFERAAAEAGTEVAVYYAGKAFLSGAMVRWMRAEGLAVDVCTGGELAVALAAG
                     AEPTALGFHGNNKSVAEIERAVAVGVGTIVIDSEIEIERVADAAARAGRIQRVRLRVN
                     SGVHASTHDFLATSHEDQKFGLPLARAVELGERIRSHASLEFVGLHCHIGSQIFDASG
                     FAESAERLLAAHAELSRTAPVPELNLGGGFGIAYTEADDPDPIEQIAERIVGRVAETC
                     ARLGVPVPKLAFEPGRWVIGPAGVTLYTVGTVKAVPIEGGERRYVSVDGGMSDNARTA
                     LYGAAYTARIASRSSDAPAALSRVVGKHCESGDIVVDRELLPADTAPGDLLAVAATGA
                     YCWSLASNYNHQPRPAVVAVRDARARVIVRGETVDDLLARDAGLEASADHDPTEGAHA
                     "
     gene            449948..451258
                     /locus_tag="MTO99_02005"
     CDS             449948..451258
                     /locus_tag="MTO99_02005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012037839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="UOE44589.1"
                     /translation="MIEYRAIRVALLGAGSVGSQVARLLLEHGDELAKRIGAPIELVG
                     IAVRDLDAKRDVDLPRDLFTADAASLIVSADIVIELMGGIEPAREYVLQAINSGADVV
                     TGNKALLASHGAELFAAAEQVGAQLSYEAAVAGAIPIIRPLRESLAGDRVERILGIVN
                     GTTNFILDRMDSTGATLEDALATATELGYAEADPTADIGGYDAAQKAAILASLAFHTT
                     VPVDAVHREGITGVTADQVESAKRAGYVVKLLAICERLADAESGAEGVSARVYPALVP
                     RTHPLAAVRGGNNAVFVEASAAGPLMFYGAGAGGVQTASAVLGDLVAIARRHVIGGPG
                     TSESTHADLPLLPIGRITTRYSVTLEVTDEPGVLETVAHVFAEHGVSVEQLQQTVEAS
                     TGRATLVIGTHEAAESALANTVASLAESPVVASVASVLRIEGAV"
     gene            451255..452352
                     /gene="thrC"
                     /locus_tag="MTO99_02010"
     CDS             451255..452352
                     /gene="thrC"
                     /locus_tag="MTO99_02010"
                     /EC_number="4.2.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011185620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004795 - threonine synthase activity
                     [Evidence IEA];
                     GO_process: GO:0009088 - threonine biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="UOE44590.1"
                     /translation="MNHPAPKTGSRQWRGVIREYADRLDVTDATPVVTLGEGGTPLIP
                     APALNRRTGADVWVKFEGMNPTGSFKDRGMTMAVTKAVEHGAKVVICASTGNTSASAA
                     AYATHAGIGAAVLVPEGKIAMGKLSQAIAHNAQLIQVQGNFDDCLDLARELAANYPVH
                     LVNSVNNDRIEGQKTAAFEVVEVLGDAPDLHFIPVGNAGNYTAYTRGYREDLAAGNST
                     RMPRMLGFQAAGSAPIVRGEPVKDPDTIASAIRIGNPASWQLALEARDETDGYFGAID
                     DQKILEAQRILSAEVGVFVEPASAISVAGLLERAEAGAVPKGSRVVLTVTGHGLKDPQ
                     WALRGADGADVQPTVVPVDTAQVAAVLGLTS"
     gene            452349..453317
                     /gene="thrB"
                     /locus_tag="MTO99_02015"
     CDS             452349..453317
                     /gene="thrB"
                     /locus_tag="MTO99_02015"
                     /EC_number="2.7.1.39"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012298857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004413 - homoserine kinase activity
                     [Evidence IEA];
                     GO_process: GO:0009088 - threonine biosynthetic process
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="UOE44591.1"
                     /translation="MTAQVADPAMSAGPVPDLVGRRVQVKVPATSANLGPGFDTLGLA
                     LARYDELEVEVLPGGALEVEVHGVGEGQVPLDASHLVVRSIAHTFARRGLGLPGLRLV
                     ARNAIPHGRGLGSSGAAIVAGVMIAKGLLEGVEAFDADDLLELATELEGHPDNVAPAL
                     FGGLTIAWVTPEGPRHKKLIVHRGVSPLVLVPEHEMSTALARSLQPESVPHSDAVFNV
                     SRSALLVAALVQSPELLLAATEDKLHQAYRAAAMPETDRLIRALRAAGHPAVVSGAGP
                     SILVLASDPSERADAVRLVEAEAETVWQALPLAVDFKGATVAPVDG"
     gene            453608..455851
                     /gene="rho"
                     /locus_tag="MTO99_02020"
     CDS             453608..455851
                     /gene="rho"
                     /locus_tag="MTO99_02020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004386 - helicase activity [Evidence
                     IEA];
                     GO_function: GO:0008186 - ATP-dependent activity, acting
                     on RNA [Evidence IEA];
                     GO_process: GO:0006353 - DNA-templated transcription,
                     termination [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="UOE44592.1"
                     /translation="MTNAPEHVEGALDSARLGTLKVAELQELAATLGIAGAAKRRKGE
                     LVELISAHQAAAAESGAVESAEPAAAPAADAEAESASPESASPESASPESAAAVESAL
                     DEASAPSEPVAPTAEPTPGDASEPDAPAAAAEPVADAPVAPARRGRQPRRATSASTAA
                     AQHVNGAGAGVALVPAADESRDEAREAARAAVREELAAATGEAPRRADAEQPETPSND
                     EPRQGGRNRRGRRGGNGGNGDREAQKSDNGQDAGRRQGDDRKVDDRKADDRKADDRKS
                     DERKSDERKSDERKGDERRGDVETDAERQGGRQNQSRDGQQPRDGQQAEGEGGRRSRY
                     RDRKRRGQGGPTDEVEPEILDDDVLIPIAGILDVLDNYAFVRTTGYLPGPSDVYVSLG
                     QVKKYHLRKGDAVVGSIKQPRDGEQPGRQKYNALVKIDSINGQTPDEAQTRVEFQKLT
                     PLYPQDRLRLETEPTKLTQRIIDLVAPIGKGQRGLIVAPPKAGKTIVLQQIANAISIN
                     NPEVHLMVVLVDERPEEVTDMERTVKGEVIASTFDRPAEDHTTVAELAIERAKRLVEL
                     GHDVVVLLDSITRLGRAYNLAAPASGRVLSGGVDASALYPPKRFFGAARNIENGGSLT
                     ILATALVETGSKMDEVIFEEFKGTGNSELRLSRQLADKRIFPAVDVNASSTRREEMLL
                     SPDEVKITWKLRRALAGLEPQQALEAVLGRLRETQSNTEFLLLMQKSAPVGGNGHGGH
                     AHESDHR"
     gene            455855..456934
                     /gene="prfA"
                     /locus_tag="MTO99_02025"
     CDS             455855..456934
                     /gene="prfA"
                     /locus_tag="MTO99_02025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020096821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003747 - translation release factor
                     activity [Evidence IEA];
                     GO_process: GO:0006415 - translational termination
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 1"
                     /protein_id="UOE44593.1"
                     /translation="MFESVRSLIAEHGELQEELADPALHADAARAKKVNRRYAELSRI
                     VHAHEVWVQAGDDLEAARELAKEDDAFAEEIPALEEQLAAAQEKLRRLLIPRDPDDGR
                     DVIMEIKGGEGGAESALFAADLLRMYIQYAQSKGWKTELLERDESDLGGYKNVQVAIK
                     SNATDPSQGVWAHLKYEGGVHRVQRVPVTETQGRIHTSTTGVLVFPEVDEPEEVEINQ
                     NDLKIDVYRSSGPGGQSVNTTDSAVRITHVPTGIVVSMQNEKSQLQNREAAMRVLRAR
                     LLARQQEELDAAASDARKSQIRSMDRSERIRTYNFPENRIADHRTGYKAYNLDAVMNG
                     ALDPIIESAIRADEEARLAAVGDDA"
     gene            457205..458179
                     /locus_tag="MTO99_02030"
     CDS             457205..458179
                     /locus_tag="MTO99_02030"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44594.1"
                     /translation="MDLDSLPRSAGGLITFGRSREIGMAASLLTARDAGDLVAVRRGV
                     YLESSRHARLTHVERHRSQAFAVAEQRPGVVFAGITAAILLGLPVVGRVPDEIVVLAP
                     ATSGRRRNGVKEIVRRTAEPDVTADGIATTSLIDTLIEVARTLPVLTALTMVDAALYV
                     PRFDTATAMCTLDELRERFDALLPFPGSRRVSVVIERATHLAETPLETLSRIRIDELG
                     FPQPELQVEVVRPRTGRIAHLDFAWREYGVWGEADGDGKYLGNARRNGDRRSVAEIVH
                     DEKQRENEVRAATKWACARWDWLEAWRTAPLRATLLEAGLPIVRRRRR"
     gene            complement(458379..458963)
                     /gene="cysE"
                     /locus_tag="MTO99_02035"
     CDS             complement(458379..458963)
                     /gene="cysE"
                     /locus_tag="MTO99_02035"
                     /EC_number="2.3.1.30"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0009001 - serine O-acetyltransferase
                     activity [Evidence IEA];
                     GO_process: GO:0006535 - cysteine biosynthetic process
                     from serine [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="serine O-acetyltransferase"
                     /protein_id="UOE44595.1"
                     /translation="MPILSRLKEDLATARAHDPAARSGLEVFLAYSGLHAIWTYRLTH
                     RLWRAGFRLPARLISQVARFLTGIEIHPGATIGRRFFIDHGMGVVVGETAVVGDDVML
                     YHGVTLGGKAPRNTPPGTKRHPTLDDGVTVGAGAKILGDITVGAWSAVGANAVVTKSA
                     PAHSLLVGVPAIVKPLSHATADAARGVHDWHWVI"
     gene            complement(459008..459943)
                     /gene="cysK"
                     /locus_tag="MTO99_02040"
     CDS             complement(459008..459943)
                     /gene="cysK"
                     /locus_tag="MTO99_02040"
                     /EC_number="2.5.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018773412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0004124 - cysteine synthase activity
                     [Evidence IEA];
                     GO_process: GO:0006535 - cysteine biosynthetic process
                     from serine [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase A"
                     /protein_id="UOE44596.1"
                     /translation="MAQIFDDITRAFGRTPLVRLNRLTEGAGATVLAKLEFYNPTASV
                     KDRLGVGIVDAAEASGALQPGGTIVEGTSGNTGIALAAIGAARGYKVILAMPETMSAE
                     RKSLLKAYGAELVLTPGSEGMKGAVARAEQIAAETPGAILARQFENQANVDIHRRTTA
                     EEVWNDTDGGVDIFVSGIGTGGTLTGTGQVLKERKPEVQVVGVEPAESPILNGGAPGP
                     HKIQGIGANFVPEILDRDVYDEIIDVNIDQAVATARRLGTEEGILGGISSGATVYAAL
                     ELAKRPENAGKTIVVIVASYGERYLSTVLYEGLLG"
     gene            460035..460931
                     /gene="prmC"
                     /locus_tag="MTO99_02045"
     CDS             460035..460931
                     /gene="prmC"
                     /locus_tag="MTO99_02045"
                     /EC_number="2.1.1.297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008757 - S-adenosylmethionine-dependent
                     methyltransferase activity [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA];
                     GO_process: GO:0018364 - peptidyl-glutamine methylation
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor N(5)-glutamine
                     methyltransferase"
                     /protein_id="UOE44597.1"
                     /translation="MNGSDAAGPRRDEGIPLRTALAEASGRLREAGVPDPDVDAELLA
                     AHVLDLSRGGVQAKVVLGAVIDAADAAELAALVARRAAREPLQHVTGRAPFRSLELLV
                     GPGVLVPRPETELVAQLAIDALRAVPEPEPVAVDLGTGSGAIALALATEVPHARVFGV
                     ELSPEALGWARRNAERVGAANLELVEGDLADALPELDRRVAVVVSNPPYVPAAMVPAD
                     PEVHRFDPAVALYGGEDGLDVIRVLSRRAFVLARPGGALVVEHAEHQSAAIAALLRAD
                     GWRAVAHHRDLTGRDRATTALR"
     gene            complement(461046..462008)
                     /locus_tag="MTO99_02050"
     CDS             complement(461046..462008)
                     /locus_tag="MTO99_02050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017204625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="UOE44598.1"
                     /translation="MSADSPAERSTAGAEPSAELELPRGVALAWGIAANPQRGPKREL
                     SIERIVEAAVEIADAEGLAAVSMSRVAQALGYTTMSLYRYVTAKDDLITLMQEHGTAL
                     PPEPDADLAPDDWRGRIRHVARAQLAQSAAHPWLLDIPIEGTPVTPNNLAWMDAMLET
                     LAPLPLREDERVAIMLLITGQVRWQGIIERSYRDAAGAAGVDPQQIDDARDAILDALV
                     TADEFPSLRRAVDAGVFREGDDPLAFGFERVLDGIAEYVSTHRDGTPAPPPLSEPDAD
                     VADDRNVREARKGIREAEKRLRDARKVERQAIRAARAKRRATGE"
     gene            462127..463083
                     /locus_tag="MTO99_02055"
     CDS             462127..463083
                     /locus_tag="MTO99_02055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012725715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0005524 - ATP binding [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="UOE44599.1"
                     /translation="MTLAIDARGLGKRFGKADVLDGLDLAVAEGSVFALLGPNGSGKT
                     TTINILTTLVRPDRGTATVAGRDVVRDPDGVRARISLTGQSAAVDEALTGRENLVMLA
                     RLSGLSARAARRRADELLERFELVDAAGRRVAAYSGGMRRRLDLGLSLVVPTPVVFLD
                     EPTTGLDPHSRLELWAVIGEIAAAGTTVFLTTQYLEEADRLAERIAVLDGGRIVAEGT
                     AAELKSRIGGDVVELRGADDELLAELPTDGSVHGLRAAVDELDRLEASGRTGSYVAIR
                     RPSLDDVFLAITGSGGRAAEAGAARGAARGAARDADLVGTKG"
     gene            463087..463914
                     /locus_tag="MTO99_02060"
     CDS             463087..463914
                     /locus_tag="MTO99_02060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017204623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE44600.1"
                     /translation="MTTVTTAAVAAAASRTDPAPRRRPRALTAESVFIRRSLLHSLRD
                     GEALLMAILLPTMLMLLFTFVFGGALDPSGGYVDYVVPGIILLCAGFGASSTAVYVAR
                     DMSTGIIDRFRTMPLRAGSVLTGHVVASLARNLLATAVVIVVALLVGFRPTAGFGEWL
                     AAIGLIALYIFAITSLFAAIGLAAGSPDAASGYGFVLLFLPYLSSAFVPVDTLPDWLQ
                     WVAEHQPITPIIEAIRGFLMGTPLGDSLWWALGWCALIIAFSAWWGAWLFRRKAGRR"
     gene            464024..464854
                     /locus_tag="MTO99_02065"
     CDS             464024..464854
                     /locus_tag="MTO99_02065"
                     /EC_number="2.7.7.87"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013493265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0061710 - L-threonylcarbamoyladenylate
                     synthase [Evidence IEA];
                     GO_process: GO:0006400 - tRNA modification [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonylcarbamoyladenylate synthase"
                     /protein_id="UOE44601.1"
                     /translation="MTAIYDCADESALLRGMRLARGAIGRGELVVIPTDTVYGLAADA
                     FSATAVQRLLDAKGRDRTAPPPVLIPGLPTLDALATEVPDAVRALVAEFWPGGLTVVL
                     RAQPSLQWDLGETRGTVALRMPDHRIALELLSETGPLAVSSANLSGLPAATTAADAHE
                     MLGESVAVYLDGGPAGDGYEAVGERPGDRSSTIVDATAVGSGGGLRILRAGVITRAEL
                     ERVVGAEAFQPDAAANVVDGASGSPEASEASDPSEASARTVATASPEATDAGAERTAP
                     "
     gene            464851..466143
                     /locus_tag="MTO99_02070"
     CDS             464851..466143
                     /locus_tag="MTO99_02070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl/decaprenyl-phosphate
                     alpha-N-acetylglucosaminyl 1-phosphate transferase"
                     /protein_id="UOE44602.1"
                     /translation="MTLFIALALLAALVSFVGSIAVWRLSLKYRLYPKIRERDVHTRP
                     TPRLGGIAMFVGILVAFGAAWVVSSFGSTRFSIIAIIFENPAQVLSILGAALLIVLLG
                     VADDLWDLDWMTKLAGQFIAAGLIAWQGVSIVSLPIGGITVGSSWMSATITVFTIVLV
                     MNAVNFIDGLDGLVAGVALIANGTFFIYSYLLVQQTSPFNYFNLASLIAVVLVGALAG
                     FLPLNWHPAKLFMGDAGALLVGLLMATSAIAVTGQINPGAVGFNQLFAAFMPIILPFA
                     ILIIPLLDFGLAVIRRLRAGKSPFSADRKHLHHRLLDMGHSHLNAVLIFYGWTAVVSI
                     GCLLTYVFPVYLGTSARWAFLLMGIGFVVCAALTLAPLGRRKRLTVAAEERPRVEGST
                     ADELSDASEASDPSAASALAAGAQPPSVDSTEPTSGAR"
     gene            466140..466619
                     /locus_tag="MTO99_02075"
     CDS             466140..466619
                     /locus_tag="MTO99_02075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013583509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44603.1"
                     /translation="MTEPTPTPADRTPTSNPVLRRALLWGALLAGVILVVAGILGLVF
                     AGVEGLVSAVIGTLIAVVFMGITAASILLANRFSNSDLFVGVFFGIVLGGWLAKFVVF
                     IVLVLVLRDVDWLNGTVLFLSIVAGVLASLVVDVLVVARSRLPYASDVQLPPAPSDD"
     gene            466809..467606
                     /gene="atpB"
                     /locus_tag="MTO99_02080"
     CDS             466809..467606
                     /gene="atpB"
                     /locus_tag="MTO99_02080"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0000276 - mitochondrial
                     proton-transporting ATP synthase complex, coupling factor
                     F(o) [Evidence IEA];
                     GO_component: GO:0045263 - proton-transporting ATP
                     synthase complex, coupling factor F(o) [Evidence IEA];
                     GO_component: GO:0045264 - plasma membrane
                     proton-transporting ATP synthase complex, coupling factor
                     F(o) [Evidence IEA];
                     GO_function: GO:0046933 - proton-transporting ATP synthase
                     activity, rotational mechanism [Evidence IEA];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit A"
                     /protein_id="UOE44604.1"
                     /translation="MNLLVQTATDDGGFHAPSIFEFFPDVVLFEGTPFAINRIMLVRF
                     VAVIALLLIFWLGTRRMKVVPGRFQSVVEFGLDFVRVQIAEDLLGKKDGKRFLPILMT
                     MFFMILFMNLTGVIPGLNIAGTSVIGVPLVLAVVSYVTFIYAGIKKSPAGFFKNALFP
                     SGVPVFVLPIVAIIELISTFILRPVTLTLRLLMNMIVGHLLLVLFFSATHFFLFGLGG
                     WWSALAAGSFAFGFAFTLFEILVALLQAYVFTLLTAVYIQLAVAEEH"
     gene            467653..467889
                     /gene="atpE"
                     /locus_tag="MTO99_02085"
     CDS             467653..467889
                     /gene="atpE"
                     /locus_tag="MTO99_02085"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019617735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0000276 - mitochondrial
                     proton-transporting ATP synthase complex, coupling factor
                     F(o) [Evidence IEA];
                     GO_component: GO:0045263 - proton-transporting ATP
                     synthase complex, coupling factor F(o) [Evidence IEA];
                     GO_component: GO:0045264 - plasma membrane
                     proton-transporting ATP synthase complex, coupling factor
                     F(o) [Evidence IEA];
                     GO_function: GO:0046933 - proton-transporting ATP synthase
                     activity, rotational mechanism [Evidence IEA];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase F0 subunit C"
                     /protein_id="UOE44605.1"
                     /translation="MDATTVLAEISGSIATVGYGLAAIGPAIGVGIVVGKTIEGVARQ
                     PELAGRLQVLMWIGIAFTEALAFVGIATGFIFGF"
     gene            467918..468484
                     /locus_tag="MTO99_02090"
     CDS             467918..468484
                     /locus_tag="MTO99_02090"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0045263 - proton-transporting ATP
                     synthase complex, coupling factor F(o) [Evidence IEA];
                     GO_function: GO:0015078 - proton transmembrane transporter
                     activity [Evidence IEA];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit B"
                     /protein_id="UOE44606.1"
                     /translation="MLHAVLSAATEGEAEANPNPLIPEVYDLVWSTVIFAILLVFFWI
                     YVLPRLQKLLDERAEAIEGNIAKADEAQRKAEAALEEYTAQLADARAEAGRIREVARE
                     DGKKIVTEAKDQAVAEAARVTASAQAQIEAERQSALVSLRSEVGTIAIDLASGVVGET
                     LTDDAKAKAVVDRFLADLEAADAAGGKK"
     gene            468488..469279
                     /locus_tag="MTO99_02095"
     CDS             468488..469279
                     /locus_tag="MTO99_02095"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009771815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0046933 - proton-transporting ATP synthase
                     activity, rotational mechanism [Evidence IEA];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit delta"
                     /protein_id="UOE44607.1"
                     /translation="MGSATREALAASRSAIGQAGSADLAVASDLLAAVRVIGATAQLR
                     SALTDNEADAPRKRALVESVFGGRIAPAAASLLVAASSNRWSSAEDFLDGVEQLGLRV
                     AADSAGDADIDAELFAFERTVASDSGLELALGSKLGSPEAKVGIVDRLLAGKAQPATV
                     AIVRHLVQNPRGRRIGEMLRDAASVVADQRGFDVATVTTAVPLSADQLARLERGLAAQ
                     AGRRIRFDTIVDPALVGGVRVQIGDDVIDGSVASRLSSLRQKLAG"
     gene            469357..470997
                     /gene="atpA"
                     /locus_tag="MTO99_02100"
     CDS             469357..470997
                     /gene="atpA"
                     /locus_tag="MTO99_02100"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0000275 - mitochondrial
                     proton-transporting ATP synthase complex, catalytic sector
                     F(1) [Evidence IEA];
                     GO_component: GO:0045261 - proton-transporting ATP
                     synthase complex, catalytic core F(1) [Evidence IEA];
                     GO_component: GO:0045262 - plasma membrane
                     proton-transporting ATP synthase complex, catalytic core
                     F(1) [Evidence IEA];
                     GO_function: GO:0046933 - proton-transporting ATP synthase
                     activity, rotational mechanism [Evidence IEA];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit alpha"
                     /protein_id="UOE44608.1"
                     /translation="MAELSISPDEIRSALSEFAQAYEPGAAQKTEVGYVTDAADGIAH
                     VEGLPSVMANELVRFADGTLGLALNLDEDEIGVVVLGEFTGIEEGMEVTRTGEVLSVP
                     VGEGYLGRVVDPLGNPIDGLGEITGIEGRRALELQAPGVMQRKSVHEPLQTGIKAIDA
                     MIPVGRGQRQLIIGDRQTGKTAIAIDTIINQKANWESGDPNKQVRCIYVAIGQKGSTI
                     ASVKGALEDAGAMEYTTIVAAPASDPAGFKYLAPYTGSAIGQHWMYDSKHVLIIFDDL
                     SKQAEAYRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPIIET
                     KANDVSAYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGDAQVKSIKKVS
                     GTLKLELAQYRSLEAFAMFASDLDAASRRQLARGARLTELLKQPQYSPYPVEEQVVSI
                     WAGTNGKLDEVPVEDILRFEREFLDYLGRNTDVLTVLRDTNVLDDDTVAKLESGVDAF
                     KLEFQTGEGKPLASVGREEFAAIAEEDVNQEKIVKGRR"
     gene            471041..471937
                     /locus_tag="MTO99_02105"
     CDS             471041..471937
                     /locus_tag="MTO99_02105"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015489868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0045261 - proton-transporting ATP
                     synthase complex, catalytic core F(1) [Evidence IEA];
                     GO_function: GO:0046933 - proton-transporting ATP synthase
                     activity, rotational mechanism [Evidence IEA];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit gamma"
                     /protein_id="UOE44609.1"
                     /translation="MGAQLRVYRQKIKSAQTTKKITKAMELIAASRIQKAQARVAAST
                     PYSRAITRAVSAVATYSNVDHVLTTEPEKIERAAVVILTSDRGLAGAFNSQVLREAEE
                     LSELLRSQGKEVVYFLVGRKAVGYFQFRHRAWERNWAGSSENPEFDLAKDISDAVLEA
                     FLRDASDGGVDEIHLVYNKFVSMMTQVPEVVRLLPLEVVEGVAEPDSVVQPLYEFEPD
                     VETVLDQLLPVYIESRIFNALLQSAAAKHAATQKAMKSASDNADKLITDYTRLANNAR
                     QAEITQQISEIVGGADALVAAK"
     gene            471960..473420
                     /gene="atpD"
                     /locus_tag="MTO99_02110"
     CDS             471960..473420
                     /gene="atpD"
                     /locus_tag="MTO99_02110"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012037855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0000275 - mitochondrial
                     proton-transporting ATP synthase complex, catalytic sector
                     F(1) [Evidence IEA];
                     GO_component: GO:0045261 - proton-transporting ATP
                     synthase complex, catalytic core F(1) [Evidence IEA];
                     GO_component: GO:0045262 - plasma membrane
                     proton-transporting ATP synthase complex, catalytic core
                     F(1) [Evidence IEA];
                     GO_function: GO:0046933 - proton-transporting ATP synthase
                     activity, rotational mechanism [Evidence IEA];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit beta"
                     /protein_id="UOE44610.1"
                     /translation="MTDTATAPVAASTAGAVGRIARVTGPVVDIEFPHDSIPEIYNAL
                     QTVITIGDQSTTLTLEVAQHLGDDVVRAIALKPTDGLVRGQEVSDTGAPISVPVGDVT
                     KGKVFNVIGEVLNAEPGETIEITERWPIHRKPPAFDQLESKTQLFETGIKVIDLLTPY
                     VQGGKIGLFGGAGVGKTVLIQEMIQRVAQDHGGVSVFAGVGERTREGNDLIHEMEEAG
                     VFDKTALVFGQMDEPPGTRLRVALSALTMAEYFRDVQKQDVLLFIDNIFRFTQAGSEV
                     STLLGRMPSAVGYQPNLADEMGILQERITSTRGHSITSLQAIYVPADDYTDPAPATTF
                     AHLDATTELSREIASKGLYPAVDPLTSTSRILDPRYLGADHYRVATTVKQILQKNKEL
                     QEIIAILGVDELSEEDKITVARARRIQQFLSQNTYMAKKFTGVEGSTVPLKDTIESFD
                     AIARGDFDHVAEQAFFNVGAITDVEEKWAQIQKENG"
     gene            473423..473683
                     /locus_tag="MTO99_02115"
     CDS             473423..473683
                     /locus_tag="MTO99_02115"
                     /EC_number="7.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017885743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0045261 - proton-transporting ATP
                     synthase complex, catalytic core F(1) [Evidence IEA];
                     GO_function: GO:0046933 - proton-transporting ATP synthase
                     activity, rotational mechanism [Evidence IEA];
                     GO_process: GO:0015986 - ATP synthesis coupled proton
                     transport [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit epsilon"
                     /protein_id="UOE44611.1"
                     /translation="MAGLNVSVVSADQEVWSGEATMVVARTVEGEIGILPGHEPMLAI
                     LAGGEVRVTLAGGEKITADAEDGFLSVQDDVVQVVASRATLA"
     gene            473697..474272
                     /locus_tag="MTO99_02120"
     CDS             473697..474272
                     /locus_tag="MTO99_02120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="UOE44612.1"
                     /translation="MPGEQPIDRQFGDLSVTRLIVMAGLPGAGKSTIGEIVGARLGAA
                     VVSVDPIESAILTAGIDADQPTGLAAYLVAETMAEAVLQAGKSVIVDAVNAVEGARLQ
                     WRDLADRTGAVLRVVEVVCTDEDLHKERLAKRVRDLPHLDELTWRAVEQSVEGYERWV
                     GSTAAMPRVTLDSIEPLGVNVDAAVRFITGS"
     gene            474272..475027
                     /locus_tag="MTO99_02125"
     CDS             474272..475027
                     /locus_tag="MTO99_02125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxide stress protein YaaA"
                     /protein_id="UOE44613.1"
                     /translation="MLVLLPPSETKREGGAGEPLRVDALSFGSLGAIRDRLVDDVIEL
                     AGDADAAFHALRLGPRQAAEVERDRRLRTSPTMPALDRYTGVLYDALDAATLDAQARA
                     YAHRHVAIHSALFGLVGALDPVPAYRLSHDSRIPGVRLKALWREAIARELDARTGLIV
                     DLRSEGYAELGPVPDRDDAVFVRVVSVDENGRRRALNHFNKRAKGLFVRALLLARPDG
                     LTTLPDLIDWAASHGFVLTAAAADRPGELELVA"
     gene            complement(475034..475555)
                     /locus_tag="MTO99_02130"
     CDS             complement(475034..475555)
                     /locus_tag="MTO99_02130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019182289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="UOE46035.1"
                     /translation="MRYHDEEWGVPQHDPVRLFEKLCLEGFQAGLSWITILRRRTAFR
                     EVFHGFDPDRVAAMDHADVERLLGDARIIRHRGKIEAAIGNARVTRELDPPLDRLLWS
                     FAPEPRDERPTSFAEVPATTPESTALSRELRRRGYRFVGPTTMYALMQACGMVDDHLE
                     GCWRAGRGDAPTG"
     gene            complement(475636..476127)
                     /locus_tag="MTO99_02135"
     CDS             complement(475636..476127)
                     /locus_tag="MTO99_02135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020075219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--[protein]-cysteine
                     S-methyltransferase"
                     /protein_id="UOE44614.1"
                     /translation="MTDVFLTRIDSPIGRLELVADESAITALSIERNGALPHDDLPER
                     TNAVLDAARIQLAEYFSGERTEFDLPVRPGGTPFQQAVWQQLARLGWGEAISYGALAD
                     AVGRPGAARAIGGAVGANPVPIIIGCHRVLASDGRITGYSGGEGVPTKVWLLGHERIG
                     FAA"
     gene            476317..477654
                     /locus_tag="MTO99_02140"
     CDS             476317..477654
                     /locus_tag="MTO99_02140"
                     /inference="COORDINATES: protein motif:HMM:NF025200.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4192 domain-containing protein"
                     /protein_id="UOE44615.1"
                     /translation="MTEIIRAGSAHEFLALVPAIAGYRPERSLVCVAFRGNRTAGLLR
                     LDLPTRIADHDSVAGQVIGTLCRMPGVDALVPVVYTSSGYASTRARREQRLLDRILRD
                     AEDAGFEVRDALRVARDGWGSVLDSETPESGHPLALIEPAGRARGATAARIADGAVLP
                     RSDARYRRAVGEAIDTFAELGRRDAFGRHGTGRRLEAALDALGESADPVVLVEQLARV
                     RLEADGEPPEALLIGWLVHLAEVPRYRDAMMLQFAFGALAGEAAFEFGLDGLDAEPRG
                     RYDDDVDEQAEGASGPDRSSPLGDPMPARLLLGLSTVRPDVDRVERALAVLRLALAHV
                     EPARRAGLACMAAWLSWALGRGSAAAVFLDLADRGDPGCTMAGLLRTFFGTGALPEWA
                     FHDELDPRDASRHDRSAAGAAVPDTTADGPTADGPTADGPGAPDVGARGLSAR"
     gene            complement(477641..479101)
                     /locus_tag="MTO99_02145"
     CDS             complement(477641..479101)
                     /locus_tag="MTO99_02145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020074878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="UOE44616.1"
                     /translation="MEPALTRRAARGQATSDAARRASFWLDSLAESGADPLRPRTALT
                     ANAWFDVCLIGGGLTALWTAYSLMRADPTLRVAVLEREIAGFGASGRNGGWCSALFPR
                     STASLERTHGREAAIAMRRAMIDTVDEVGRITAAEGIDCDFVRGGTVVFARSDAQRSA
                     ARAEVEESARYGVDRLEYWDERRVAERFDVSGADDRTPAAVYDPACARVHPAKLVRGL
                     ARAVERLGVAIFERTEVLDWSAGRVRFRALDGSGATGTVSARHVLVATEGYSPRLPRA
                     RRRILPIFSLMIATEPLPPEVWNRIGLTHGETFSDYRHLLVYGQRTADDRIAFGGRGA
                     RYHWASAVDPRFEQDDRVFAHLASTLRDLFPAVGDARITHRWGGPLGIARDWHPTVSY
                     NPRTGVGFAGGYVGDGLSTTNLAGRTLADLVLGRTSELTALPWVQHRSPLWEPEPLRW
                     VGANLGILGTGLADREERLTGRPSLIARAIGPLTGH"
     gene            complement(479086..480483)
                     /locus_tag="MTO99_02150"
     CDS             complement(479086..480483)
                     /locus_tag="MTO99_02150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013583238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0008483 - transaminase activity [Evidence
                     IEA];
                     GO_function: GO:0030170 - pyridoxal phosphate binding
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="UOE44617.1"
                     /translation="MTDVSTEARLDAALLQQQAKDHLWMHFSRQSTMEQGVPVIVKGE
                     GHHIWDIEGRRYIDGLAGLFVVNAGHGRRRLAEAAAKQASELAFFPIWSYAHPAAIML
                     ADRLAEEAPGDLNHVFFSTGGGEAVETAFKLAKYYWKLQGRPTKHKVISRSVAYHGTP
                     QGALAITGIPAMKEMFEPVTPGGFRVPNTNFYRAAEMGAPADDLEAFGRWAADRIEEM
                     ILFEGPETVAAVFLEPVQNSGGCFPPPPGYFQRVREICDRHDVLLVSDEVICAFGRLG
                     RTFACDAYGYVPDMITCAKAMTSGYSPIGATIVSDRLYEPFAHGNTSFSHGYTFGGHP
                     VSAAVALENLAIFDEEGLNERVREHSPLFRAELEKLLDLPIVGDVRGDGYFFGIELVK
                     DKATRETFDDDESERLLRGFLSKALFDAGLYCRADDRGDPVIQLAPPLTIGPAEFTEI
                     EQILRGVLTEAWSRL"
     gene            complement(480480..480974)
                     /locus_tag="MTO99_02155"
     CDS             complement(480480..480974)
                     /locus_tag="MTO99_02155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017885157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="UOE44618.1"
                     /translation="MTNTGRSPARPVQLDEVSKAIIEQLQVDGRRSYADIGKAVGLSE
                     AAVRQRVQKLTESGVMQIVAVTDPMQLGFTRQAMIGVRASGDTREVAARLAEIPEIDY
                     VVLTAGSFDVLAEVVCEDDAQLIALLNERIRSIPGVQSTESFVYLMLQKQFYNWGTVR
                     NRES"
     gene            481182..482171
                     /locus_tag="MTO99_02160"
     CDS             481182..482171
                     /locus_tag="MTO99_02160"
                     /inference="COORDINATES: protein motif:HMM:NF012708.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FHA domain-containing protein"
                     /protein_id="UOE44619.1"
                     /translation="MVDGRIRVARERGRPEWEVIAGVRFVVALEAPAQPAAVRAFILA
                     AGDRDATLEQLIAATPLAGEAGEGFVLAWWPPGTDPLPDVTVVARGAAVVDLASPGGS
                     RRFEAREVRPWHLAEFGDVERIRISGRGAPLDGDASGELLGDDGRAAGVTTVEWRASQ
                     HALEAARAHAWASPEDAADTSLLAHAAPGTTDPTDPVEAIEARTEPVARFRIGQGPPR
                     DIRSRIVLGRRPAAPRLPGDPVELVRVEDDRRVVSASHLELRAEGGRVVATDLRSTNG
                     TIVESTARSHRMRAGESIVVRPGTRLRLGGDTIVEILPPRIDRPSGLDRQAPA"
     gene            482168..482953
                     /locus_tag="MTO99_02165"
     CDS             482168..482953
                     /locus_tag="MTO99_02165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase 2C domain-containing
                     protein"
                     /protein_id="UOE44620.1"
                     /translation="MTQIGNANTRHRMTLPGGATVTLSWAAETHVGHRRVVNEDSFVA
                     QAPVFAVADGMGGHAAGDFASAAVVTRLAEHGGQTVIGTPEVDHALRLAVQDMGRSTG
                     VTDEGSGTTVTGVGLTEISGEPAWIVFNIGDSRVYRLIGGVLEQLTVDHSIVQELVDA
                     GQITRDEADTHPHSNVITRAVGFHETPLPDYRAIAVEAGMRLLICSDGLTKELTSYGI
                     RHFLMASRRPERSARDLLDAALGNGGRDNVTVVVVDVVAVDRD"
     gene            483095..484495
                     /locus_tag="MTO99_02170"
     CDS             483095..484495
                     /locus_tag="MTO99_02170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="UOE44621.1"
                     /translation="MNRRLPSTPPTLPGFVFVRALGSGGFADVFCYEQDMPRRVVAVK
                     VLLAELVNDEVRRMFRAEADLMAQLSSHPSILTVYQAGVAADGRPYLVMEYCSSTLAE
                     RYRSAPLPISEVLAIGVRISSAVEAAHRQGVLHRDIKPSNILTTAYGHPVLGDFGIAA
                     SVVEGEHGAAGVSIPWSAPEVLADDRASVASEVWSLGATVYSLLAGRSPFEVPGGANG
                     SAALIARIEKARLNPTGRADVPERLEQVLARAMSRRPAERQASALELLRDLQAVEEEL
                     GLSQTPGDLEVQEWASAPLADPVDPVDRTRLAPAAEPGEAGGRRAESRGARRWVSDGP
                     ADASIGVPAPPSRRRLGWGVAAALAMLVGVIAAGAGFWLALGSDDPIPVVADLRADVD
                     GTIVTFAWDDPGIDEREAFLVRVEGQDTPARRETALDVPARAGERLCATVRVTRDGRS
                     GAPSAERCVEVEESGG"
     gene            484492..490371
                     /locus_tag="MTO99_02175"
     CDS             484492..490371
                     /locus_tag="MTO99_02175"
                     /inference="COORDINATES: protein motif:HMM:NF037016.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ig-like domain-containing protein"
                     /protein_id="UOE44622.1"
                     /translation="MRSPRMLRGRRSAVLTATAVLVVVGAVSGAAVASSGYREQEVDL
                     GDASVWVVNDELGAVGRAGTAVGELVSLVDAGGDDSEIVQRGATVLVVDREKSGVGVL
                     DPANAAIVTTVPLPPGQAEVSLAAGRVVVVSGGAVWWTSIAGFADFDADTDPMLSFGA
                     DAQISVDEAGGLFAYTPSTGQVVRVDVTAGATVTDTWQLDPVDGTPDVQISSIADRWV
                     VLDRSASVLRTADGAVDLAETVRPGDGAVLQLPSTVGDAVAVATREHLVAVPLDGQAV
                     RTLVADRSGTPARPIRHDGCLHAAWAGGSAWRSCGDGAVDLPGGVESGAQLSFRTNGR
                     ALVLNDAHSGRSWAAASDYELIDNWDELADAIRDDTTIEQNDPDVDPTVEKEQQPPKA
                     EPDRFGARPGRATLLPVLLNDQDANADVLVIDAIQGVLPEGATVVPVQSRQLLQLQLG
                     EAVRGEFAFGYTISDGRGATASAEVTITVRGPDENGPPVQVRRADAVVQAGGRLSQAV
                     LGEWMDPDGDPIYLREATTDAPDRVSSTPEGAVVFDADGGAAGSKRVGLVVSDGRDEG
                     VGELRVDVRDAGDVLLVADPFVALATAGEEIVLEPLRHVRGGSGHPQLTAVPARPDAR
                     VLADFDGGTVRFSSATAGTHYLEYTVVDGDRTATGVIRVEVSPPPERDTTPITVPHTA
                     FLQTGRAGEVDVLATDIDPTGGVLVLTTLTATAEDQGVRVEIVDHRILRVTLLRPLET
                     GSAELRYRVSNGLADAEGRVALLEVPPPRVPEPPVADDDRVSARVGDVVDIDVLANDE
                     HPDGETLTLDPELVVEPDAGLLFVSGDRLRYFAPGEPGQYRASYKVSGPDGQFATAWV
                     DLTVRVADPDTNTKPVPREVTARAFAGETVRIPIPLSGVDPDGDSVELLGQVSNPERG
                     TVVERGAGWLDYRAGEYSSGTDVFRYAVVDALGGRAEGQVRVGIAERPSVPDRPVAVE
                     DSVLVRPGRTVAVRVLANDSDPGGSPLVLTGVSALDPDTTARLDGESLVVRLPDREGV
                     FGFEYSLRNANWSTASGHLTVETREDAAPARPEASDVVLTLNDIVDRDEVDVDVKEQV
                     FLADASLARMPVRLVPGYDDAAEVLPDGRVRVQVGDQRQIIPYEVVHPDDPSIGAYAF
                     IWVPGCDDAIPQLRTDAPEVRVQSGEEVRIELADHVIAASGRPVQVADRAGVRAVHGD
                     GTDLVVDADTLRYRSEEGYFGPASISLTVTDGDGPDDPTARTGTIVIPIVVEPVEGQP
                     PSFVGQVLDLEPGQPKTIDLVRLTTHPYARTGEGLSYRVIDASEDFSVSLSGSRLVIQ
                     AASQAATGTSGRVTIGVSAGQVAGTPGVIELHVVPSTRPLARPADDVAVVVRGATTQV
                     DVLANDQPGNPFPREPLRVVGLSGLDATNLPRGVHVQPSDDRATLTVRVDGDAAPGDT
                     TIGYVVEDATGDPARRAWANVRISVQDRPAPVADLRMTGFGDRRIDLAFAAGVANNSP
                     ITGYRVDLIDVDTRERIGGSLCEATTCSAATAGNGAANAVIVRVTARNAIGDSAPVEL
                     GGAVWSDVVPAAPTGLVAQPRDGRLLIAWSPVAVRGGSAVRSYVVTVAGVPVEVAATA
                     ACTASACSIESQALANGSVVPFAVSARNDAYPALAQWSEASGVGTPFGRPVAAAASAV
                     ADDASGTVTVSWPGFEGNGDPVLGYFVQRLVSPDAVPTGAQTCSVTAPAPGTVVRPTN
                     GGAVAETIETDGATRSVAFSGAVGAPGRYGFVVWGWNRAGCVRGDVVQATVRPAPGPV
                     GEVSSRMDWLAVNDTWDRRIDSVQAGGSLLEIVAVDDRGVQIGAPRSFAGSGWLRELL
                     QRPFGETARFQVRACTVWGSCGPWSDPLPTGSSPSLTFALPGLTVSGDGPRGGVVWRW
                     SGDPGNSGLPAAYRCGAEGDDVGRPAQGPVSCRIDGARANDRVWLDVEVAGVTARKWN
                     R"
     gene            490383..491354
                     /locus_tag="MTO99_02180"
     CDS             490383..491354
                     /locus_tag="MTO99_02180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MoxR family ATPase"
                     /protein_id="UOE44623.1"
                     /translation="MTMTPDEAAAFAADLDRLVGAVEDVLLGKNRIVRLAFIALLSEG
                     HLLLEDVPGTGKTSLARAMAQSVAGTSNRVQFTPDLLPGDITGVTVYDQRTGRFDFHP
                     GPVFANIVLADEINRASPKTQSALLEVMEEGQVTVDGQTHAVGHPFMVIATQNPIEQA
                     GTYRLPEAQLDRFLMRSSIGYPDHASTIRILEGADQRAHAHIVEPQLDAEHVVDMAAA
                     ARTVFVDPTIHDYVSRLVEGTRSAREVRLGVSVRGALALIRAAKTHAASRGRHYVVPD
                     DVKALAEPVLAHRLILDPEAEFDGVTTSNVVAQVLIETAPPSTRQAM"
     gene            491351..492655
                     /locus_tag="MTO99_02185"
     CDS             491351..492655
                     /locus_tag="MTO99_02185"
                     /inference="COORDINATES: protein motif:HMM:NF013998.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF58 domain-containing protein"
                     /protein_id="UOE44624.1"
                     /translation="MSHAPTPAGPRDRAREGALAAGIAAAVGGGRRLTAGAVRGGRWV
                     RGVVTPVGWAVAGAAVVALVVGYLFGWLEPVLIGWGLAVAAAVASLWLIGRGAASIRL
                     ELSTPRVAVGEAASARLVAENPAGRRLIGLIVEVPVGGRIVERVLPALSRGGRFDETF
                     PIPTERRGVVAVGPVRTVRADPLALVRREIVWSDPEVLHVHPRIAPVEALSSGLIRDL
                     EGAPTRDLTSSDIAFHALREYQPGDDRRHIHWRSSAKTGTFMVRQFEQTRRSRLLVLL
                     DLDRSAYRDDAEFELAVSVAGSVGVRAIRDARTVAFVVSAARTGGGAFDELPTVSRDR
                     LLDALCLVEADDRAAPLPDVARAVGEGLHGLSLAIIATGSARGVAAVRQAAVRLPSGI
                     ESIGVLCTADGTPSARQVGALTVFRVGRLDDLRSMLARSAAA"
     gene            492652..495006
                     /locus_tag="MTO99_02190"
     CDS             492652..495006
                     /locus_tag="MTO99_02190"
                     /inference="COORDINATES: protein motif:HMM:NF023418.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3488 and transglutaminase-like
                     domain-containing protein"
                     /protein_id="UOE44625.1"
                     /translation="MSSRHPRQAAAAAAAARSRVRAAPRQGAGAITVEVLLIAGMIAA
                     AAIPWWPVYESPAFAVAVAVAAGAGLAIGVAGALARWPAWLVVTSVAGAFLVLGVPAA
                     IPGLAFATVLPSPQGLVELVVATWASWKQLVTVAVPVGSYQSLLVPPFLLALIAAAAA
                     ATIALRSRFPGAAVLPPAGLLVVGIAFGTVHGEAAFETGIAFLLLAGAWLVRLSIARR
                     RALGVDRRSVAVIADARRVLGAVAIGAVAVTGAGLAAAAVPAGPRQVVRADLQPVFDP
                     RDLLSPLAAFRTAFEPAVADRPMLDVQGLPEGWGLRLASLDSYDGVVYSVGAGSSGAS
                     GRFARLPYRLDQSDTPGDPVRLDVLVREYDDVWVPGVGRLERIDFDGPRAVELTQRFA
                     YNDTTGTSALVGGLRAGDRYTAESIAAAPLTAVSGYKPGTAVVASGPDLPDSLRRALE
                     EWAPSTLTEGERLAALIAGIRRDGYVSHGLPDEPASRPGHSLDRLEELVSERPMVGDG
                     EQYAVLAALLAREIGFPTRVAVGYLAADATDASAPTDASDATTTLVASDLRAWIEVQT
                     SDGGWRQVDPNPDARDIPERSPDEPTVVSRPQSVLPPPERRTPVEDLDIDPEGARDEG
                     DEGVDPWPAIAGRIAAGTGIVLLAGMFVASPFAAILIAKARRRRIRRSAADPVSRIEG
                     AWEEFADTAVDHGYLLPQGGTRAEQAATVGGLLPLALASAVDRAVFAPAAEVADTQAT
                     EVWSAVDRLRTGLERDRGRGARLRARVSLRSLGGYAVPRRGGRA"
     gene            495003..495545
                     /locus_tag="MTO99_02195"
     CDS             495003..495545
                     /locus_tag="MTO99_02195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011186051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44626.1"
                     /translation="MRCRICTADLPAGAMFCGECGSSTSATPESRRLVDPRPGDTTIL
                     HRSPSGVVSVSLPSTAPDPVAVAPPARPGTTFTLRFSTGEVRTVFGTGLVGRNPLPQP
                     GEAFDHLVQIADRTLSVSKTHLEFGQHDGDLWVADRFSGNGTILRRGPDGAVRCEPGR
                     RYLVPRGGLVQLAEQSFEVS"
     gene            495641..498766
                     /locus_tag="MTO99_02200"
     CDS             495641..498766
                     /locus_tag="MTO99_02200"
                     /inference="COORDINATES: protein motif:HMM:NF013727.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44627.1"
                     /translation="MPRRRAHSNADAATPAALSAVPRAAGTLATVPSLAAEPVLSLPA
                     PVPEAPRAGFPVLATLAPIGGAGVLWALTGSTFALVFAALGPLAAVASLLDGRRQRRR
                     TLRRAALERATAFAELDERVRAGHDAERAEAWRRAGSARTVLAAPPGSDWRHRDAGSA
                     VLGRAAGRSALRLDGTPSDDLDRAALARAAICDDLPLAAPVGDGIGFVGPIALARSAA
                     RAALVQAAHRAAPGAVTVDLPRDGWSWARALPHRRGDRRILVVDAASHGAGAAGVGAT
                     LGATLGAGGGDAGCIAVAPTEAGLPPGLATVLRLESPTAAVLVRHAGFADHRPVVPHL
                     VSEREAAEWARAVGRAAATAASPAEPPQSVHWGSLPQPAGELDGRARLRAVVGRSADD
                     TVELDLVADGPHALVAGTTGSGKSEFLLAWVAALAAAYPPEAVAFLLVDFKGGAAFAP
                     LIGLPHVTGVVTDLDESEARRAVASLRAELRHREQVLTTAGARDLTSLGATTTLPRLV
                     VVVDEYQAMIERFPALGEVIADLAARGRSLGVHLVLAAQRPNGVVREAITANCPLRIS
                     LRVLAAADSTAVIGSDLAARLPAEVPGRAVLVRGDGRPTPFQSALADAAALERLHLRR
                     AGAAPARRPWLAPLPHRLPADHPELVAVRRSADGSVVFGLADDPGRQRRVAAGWHPDR
                     DGNLLVVGAPGSGRTGALDAVADAWRRDRPGGEVVVLGGPRSRQWDTLRSELDAARSG
                     GGADRLLVIDDLDLRFRAWPEPYRLEAADLVESLTREGRGGGLAVAASARSANAAGRA
                     GLDGFGQVLRLRHASRMELVQAGGVGDLWNDADPAGAGQWRGLRVQVVEASPSRRHDP
                     IPGEGAPALTAADLLAPGARGVAVVSTVPRADGPAVAALLGADPLVFDARPDAARAAE
                     AALAAAPAAGEPGERVVLAADAESWAGAWAVAAAVREAGVVVVRGGPAEYRALARDRG
                     LPPLLDERPPQCWVLRPGEAPARRSWPTTVSTSAVQVRARTTETVENRRFEMRIPSKD
                     SSEGNESAMNA"
     gene            498865..500049
                     /locus_tag="MTO99_02205"
     CDS             498865..500049
                     /locus_tag="MTO99_02205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020074865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="UOE44628.1"
                     /translation="MIRSLVLQARRAQLTRRSLLAGAGAGASALALAACSTGGGQAKP
                     TAAADTSATDKTLAWANWAAYIDEDDDGNYPTLQAFEAQTGITVTYDVAVDDNNTYYG
                     KVKDQLQLGQDIGADTVCLTDWMVSRWIRLGYTQELDHANIPNLTNLEPALRDPDFDP
                     GRTYSVPWQGGFAGICWNTEVIPGGLESVEDLWNPELKGRVGVLSEMRDTMGLIMLQN
                     GVDIAGDWGDDEFTAGIDVLREQVENGQVRNIKGNSYLEDLKSGDTLAAICWSGDITV
                     INAEAGDKWQFALPTAGGTLWNDNFLVPIGSPRKTNAETLINYYYEPEVAAEVAAWVN
                     YITPVVGAKEAAVAIDPELAENQLIFPDDETLSQAHIFRSLSGAEEQRYQAEFQSILL
                     GA"
     gene            500062..501261
                     /locus_tag="MTO99_02210"
     CDS             500062..501261
                     /locus_tag="MTO99_02210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="UOE44629.1"
                     /translation="MAVREFAERGADLQLVGIQKRFPGFTAIEELDLTIPAGSFFALL
                     GPSGCGKTTTLRLVAGLEEPTRGRILIGGTDVTATKAHERPVNTVFQSYALFPHMTII
                     ENVAFGLKRRRISDAVGRAHEALKLVELDHLAQRRPQQLSGGQQQRVALARAIVNRPA
                     LLLLDEPLGALDLKLRRQMQLELKSIQEEVGLTFLHVTHDQEEAMTMADTVAVMNQGA
                     IEQMGAPEELYDLPRTVFVANFLGQSNLFTGPVAGTTAEAISIDVAGTPVRIPTARAR
                     RHQGTVTVGVRPEKVALHETEPAAASDRNVLGPGRVIDVSFSGVSTQYLVDVPGAGTL
                     LVFAQNIGHGPAAAVGAEAWVSWHVEHGFGLADDASAQPRFQPDATTSAIAAQQRDAL
                     ASELEEA"
     gene            501261..502172
                     /locus_tag="MTO99_02215"
     CDS             501261..502172
                     /locus_tag="MTO99_02215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE44630.1"
                     /translation="MAFAAFATAEAQPQAPRRRSPIALFLLLPGIAYLVLFFLTPLVS
                     LLLTSLQQPSEFGDIGVYEFAFNWQNYVAVIEAYWPHILRSFGYALAATVFALLFSYP
                     LAYFIGVKARRWPLLQSLMLVLVIAPFFISFLLRTLAWKQILSDESFIITSLKALSLL
                     APDAHFAGTPFAVIFGLTYNFIPFMTLPLYTALERLDTRYLEAGSDLYANPFTVFRKV
                     TIPLSMPGIVAGTLLTFIPAAGDYINASRDFLGGPDTQMMGNVIEANFLVLLNYPAAA
                     ALSIILMAVILVLVGVYVKRSGTEDLL"
     gene            502319..503101
                     /locus_tag="MTO99_02220"
     CDS             502319..503101
                     /locus_tag="MTO99_02220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010203626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="UOE46036.1"
                     /translation="MLPAYTIIAFVFLLIPIAYTFVFSFNDSLKSNISWRGFTFDKWL
                     NVCTVEGGAVCEAFGNSIVIGVVSTVVATALGTMIAIALVRYRFRARSATSLLLFLPM
                     ATPEVVLGAGLAAQFLAVGVPKDMLTIILAHIMFCISFVVVTVKARVASLDPALEEAG
                     RDLYGSPIQVFWRVTFPLLLPGILAAALLSFALSFDDFIITNFNSGSVTTFPKYVYIS
                     ASRGIPAEANVIASAVFLFAIILVVTAQVSRAARAKRLAKQG"
     gene            complement(503129..504118)
                     /locus_tag="MTO99_02225"
     CDS             complement(503129..504118)
                     /locus_tag="MTO99_02225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020096832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparaginase"
                     /protein_id="UOE44631.1"
                     /translation="MAGIFSSSDAVELAVVVRSGFTESRHAGSAVVLSPEGEVVRELG
                     DIRSPILPRSCLKPFQAIAAMTSGVTLRGEDAAIATASHSGTAAHVALVKGLLARAEL
                     LPAVLGCPPALPLDRAAREQVVRSGGGPERATMECSGKHAAMLLACAANDWPLESYLD
                     AGHPMQRKVLDVLERLSGERPSAIAVDGCGTPVFAISLAGLARGIQKITTAQSTSPFA
                     LFREAAALTSAVREHAWAAGGPGQPDTVAVERLGVFAKRGAEGVMVMTAPNGTTTAVK
                     VLDGSQRASTIVALRLLADAGAIEHDAVDAVQAELDLWVMGGDRPVGEIRATV"
     gene            complement(504121..505494)
                     /gene="gabT"
                     /locus_tag="MTO99_02230"
     CDS             complement(504121..505494)
                     /gene="gabT"
                     /locus_tag="MTO99_02230"
                     /EC_number="2.6.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_function: GO:0003867 - 4-aminobutyrate transaminase
                     activity [Evidence IEA];
                     GO_process: GO:0009450 - gamma-aminobutyric acid catabolic
                     process [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate--2-oxoglutarate transaminase"
                     /protein_id="UOE44632.1"
                     /translation="MTDSIDTEVSAAPDRVVTQERRIVTAVPGPASQELHRRRRAVVS
                     DGVSSALPVYIAHANGAVLVDVDGNQFVDFGAGIGVTTVGHTEASVVAAAASQLQDVI
                     HTLFTITPYEPYVRVAELLAERTPGDWAKKSVLVNSGAEAVENGVKIARRFTGRRAVA
                     VLDHAYHGRTNLTMAMNYKAMPYATGFGPFAGDVFHAPNSYPYRDGLSGEDAAARTIA
                     YLEKVVGASDLACLVVEPIQGEGGFIVPADGYLPILQHWCTEHSVVMIADEIQSGMAR
                     TGRWYASEHFGWEPDLVLSAKGIAGGLPLAAVTGRAEIMDASQPGGLGGTFGGNPVAC
                     AAAVAVFETIEQNGLLAEAERIGRTLTAGLERLKARYDVIGEVRGTGAMIAIELVQPG
                     TGATAKRPNADAVSQIVAYAAQRGILFLNAGTWGNVLRFLPSLAMSDALIEDALTVLD
                     DAFADLG"
     gene            505549..506043
                     /locus_tag="MTO99_02235"
     CDS             505549..506043
                     /locus_tag="MTO99_02235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018761587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family protein"
                     /protein_id="UOE44633.1"
                     /translation="MRLGEHRFDLHLEWTPEAGADPTGARPGARSARRAHLVNAPGKL
                     HPVEGSAARAFHGDPERWNPEELLLAALADCHLLSYLYVAAKHGVVVRAYTDEPTAVL
                     HEDGRGGGSIVEAVLRPRVTVAEASMTGLAMELHREASELCFIAASVAFPVRHEPTVD
                     VLGD"
     gene            complement(506058..506987)
                     /locus_tag="MTO99_02240"
     CDS             complement(506058..506987)
                     /locus_tag="MTO99_02240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018190870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44634.1"
                     /translation="MRSSRLARVVAAMVAASALLAGLAACTAAPAAPRVSPGATATEG
                     AEPSTEAFDPALIVSDDAFFDSTAMSEADIQRFLEQTACRPDADVVCLARFRETTTDQ
                     PDEGPGHCDAYEGAPRERASRILQRVAAACGISPRTLLVLLQKEQSLLTRPTAYGYQR
                     ATGYGCPDTADCEQKYFGFFNQVYNAAWQFRQYTEHPDRAYRIGVVDVAFHPDAACGA
                     QPVDIRNQATANLYNYTPYQPNAAAVLDPETGDACSSWGNLNFWRLWWRWFGDPTAER
                     FAGFLPACSRLVGGHPCPPAVTIPAAPPIAPES"
     gene            complement(507041..507793)
                     /locus_tag="MTO99_02245"
     CDS             complement(507041..507793)
                     /locus_tag="MTO99_02245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013583485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="UOE46037.1"
                     /translation="MEADALPAAPKAPGALYRTVRLLLRPIVLVLYRPRIEGTKLVPK
                     DGPVIFASNHLSFIDSVVIPLTAPRPVQFLAKSHYFTGSGVKGWISRTFFRSIGAVSV
                     ERGAGSQAQEALDQGRRILESGSAFALYPEGTRSLDGRLYRGRTGVAWLALTTGARVV
                     PVGLIGTQEIQPVGQKLPRIRPVTVRFGEPLDLSAHGPAESGRARRAATDEVMAAIHA
                     LSGQELAGKYNETPPEGAIAKLVDRVVPRERI"
     gene            507852..508496
                     /locus_tag="MTO99_02250"
     CDS             507852..508496
                     /locus_tag="MTO99_02250"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="UOE44635.1"
                     /translation="MGEDDGMGLLDDADLVAFEDGLVTAAVFGGRRRPSAEAALAAVL
                     AARTGVPADDVELGWACAECGSRHGAPAIEYPPGPPGLPWRGDAAAHGSLLVAASAPG
                     LRIGIGFAAGVGSAVEDAAFHRSELDAIDEAPHRARDSVRHVLWARKSALLRALGHSL
                     PLEPAALALSAPTADGAPGRIVRPVAEVGGNWADVRVHDLVVPGGAVAALAVLP"
     gene            508530..509612
                     /gene="dxr"
                     /locus_tag="MTO99_02255"
     CDS             508530..509612
                     /gene="dxr"
                     /locus_tag="MTO99_02255"
                     /EC_number="1.1.1.267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005048669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology.
                     GO_component: GO:0005737 - cytoplasm [Evidence IEA];
                     GO_function: GO:0030604 - 1-deoxy-D-xylulose-5-phosphate
                     reductoisomerase activity [Evidence IEA];
                     GO_process: GO:0019288 - isopentenyl diphosphate
                     biosynthetic process, methylerythritol 4-phosphate pathway
                     [Evidence IEA]"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate reductoisomerase"
                     /protein_id="UOE44636.1"
                     /translation="MQRVIVLGSSGSIGTQALDVIRANPRRFEVVGLAVGSDRETLAA
                     QAAEFGVDDVALGIDEAVQLVRDVDADVVLNGITGSVGLGPTLATLERGTTLALANKE
                     SLIVGGDLVTRLAAPGQIVPVDSEHSALAQALRSGTDAEVRRLVLTASGGPFRGRTRD
                     ELHQVTPAEALAHPTWDMGLVVTTNSATLVNKGLEVIEAHLLFGVPYDRIDVVVHPQS
                     IVHSMVEFIDGSTIAQASPPDMRLPISLGLDWPHRVAGVGRPLDWTTAQSWTFEPLDD
                     EAFPSVALAKQVGRAGGTYPAVFNAANEQAVQAFHAGAIGFLGILDVVRGVVDAHDPG
                     EGALGLESLAEAERWARSAADRLIAG"
     gene            5096