LOCUS BC070213 701 bp mRNA linear HUM 03-JAN-2005
DEFINITION Homo sapiens SLAM family member 9, mRNA (cDNA clone
IMAGE:30416664), complete cds.
ACCESSION BC070213
VERSION BC070213.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 701)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 701)
AUTHORS Director MGC Project.
TITLE Direct Submission
JOURNAL Submitted (10-MAY-2004) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Narayan Bhat
cDNA Library Preparation: CLONTECH Laboratories, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 57 Row: p Column: 13
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 15559204
This clone has the following problem: The cds is short compared to
the longest cds in the locus.
FEATURES Location/Qualifiers
source 1..701
/db_xref="H-InvDB:HIT000264171"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:30416664"
/tissue_type="Blood, peripheral blood mononuclear cells
(PBMC) cytoplasmic poly A RNA is pooled sample from 3 and
6 hr after stimulation with PMA and Ionomycin. These
reagents are used to activate T- cells that results in
lymphokine and cytokine production."
/clone_lib="NIH_MGC_191"
/lab_host="DH10B"
/note="Vector: pDNR-LIB"
gene 1..701
/gene="SLAMF9"
/gene_synonym="CD2F-10"
/gene_synonym="CD84-H1"
/gene_synonym="PRO4421"
/gene_synonym="SF2001"
/db_xref="GeneID:89886"
/db_xref="MIM:608589"
CDS 390..506
/gene="SLAMF9"
/gene_synonym="CD2F-10"
/gene_synonym="CD84-H1"
/gene_synonym="PRO4421"
/gene_synonym="SF2001"
/codon_start=1
/product="SLAMF9 protein"
/protein_id="AAH70213.1"
/db_xref="GeneID:89886"
/db_xref="MIM:608589"
/translation="MGLWVIRVQKRHKMPRMKKLMRNRMKLRKEAKPGSSPA"
BASE COUNT 192 a 179 c 178 g 152 t
ORIGIN
1 ggactgactg actgaatcac acctctgggg ctgggggctg ctgacatgtg tgcctttcct
61 tggctgcttc ttctcctgct gctccaggag ggcagccaaa ggagactctg gagatggtgt
121 ggatccgagg aagtggttgc ggtccttcag gagtccatca gcctccccct ggaaatacca
181 ccagatgaag aggttgagaa catcatctgg tcctctcaca aaagtcttgc cactgtggtg
241 ccagggaaag agggacatcc agctaccatc atggtgacca atccacacta ccagggccaa
301 atcctaacta tgcttctgag aagccttcaa cagccttctg cctcctggcc aagggattgc
361 tcatcttctt gctcttggta attctggcca tgggactctg ggtcatccga gtccagaaaa
421 gacacaaaat gccaaggatg aagaaactca tgagaaacag aatgaaattg aggaaggagg
481 caaagcctgg ctccagccct gcctgactgc tccttgggaa ccccagtcct gagcttggtt
541 tcttcccagc acccagagaa tccttcctca gctctcttct ttccagggga aggaggtgct
601 caggggtggg tatccagaga gccatacttc tgagggaaga ctggctggca ataaagtcaa
661 attaagtgac cacataaaaa aaaaaaaaaa aaaaaaaaaa a
//