LOCUS BC067512 618 bp mRNA linear HUM 30-JUN-2004
DEFINITION Homo sapiens interleukin 23, alpha subunit p19, mRNA (cDNA clone
MGC:79392 IMAGE:6971852), complete cds.
ACCESSION BC067512
VERSION BC067512.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 618)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 618)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (19-MAR-2004) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Narayan Bhat
cDNA Library Preparation: Bhat Laboratory
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAK Plate: 172 Row: d Column: 17
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 28144902.
FEATURES Location/Qualifiers
source 1..618
/db_xref="H-InvDB:HIT000262670"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:79392 IMAGE:6971852"
/tissue_type="PCR rescued clones"
/clone_lib="NIH_MGC_195"
/lab_host="DH10B"
/note="Vector: pDNR-Dual"
gene 1..618
/gene="IL23A"
/gene_synonym="IL-23"
/gene_synonym="IL-23A"
/gene_synonym="IL23P19"
/gene_synonym="P19"
/gene_synonym="SGRF"
/db_xref="GeneID:51561"
/db_xref="MIM:605580"
CDS 34..603
/gene="IL23A"
/gene_synonym="IL-23"
/gene_synonym="IL-23A"
/gene_synonym="IL23P19"
/gene_synonym="P19"
/gene_synonym="SGRF"
/codon_start=1
/product="interleukin 23, alpha subunit p19, precursor"
/protein_id="AAH67512.1"
/db_xref="GeneID:51561"
/db_xref="MIM:605580"
/translation="MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLA
WSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEK
LLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLL
LRFKILRSLQAFVAVAARVFAHGAATLSP"
BASE COUNT 141 a 177 c 172 g 128 t
ORIGIN
1 agagccagcc agatttgaga agaaggcaaa aagatgctgg ggagcagagc tgtaatgctg
61 ctgttgctgc tgccctggac agctcagggc agagctgtgc ctgggggcag cagccctgcc
121 tggactcagt gccagcagct ttcacagaag ctctgcacac tggcctggag tgcacatcca
181 ctagtgggac acatggatct aagagaagag ggagatgaag agactacaaa tgatgttccc
241 catatccagt gtggagatgg ctgtgacccc caaggactca gggacaacag tcagttctgc
301 ttgcaaagga tccaccaggg tctgattttt tatgagaagc tgctaggatc ggatattttc
361 acaggggagc cttctctgct ccctgatagc cctgtgggcc agcttcatgc ctccctactg
421 ggcctcagcc aactcctgca gcctgagggt caccactggg agactcagca gattccaagc
481 ctcagtccca gccagccatg gcagcgtctc cttctccgct tcaaaatcct tcgcagcctc
541 caggcctttg tggctgtagc cgcccgggtc tttgcccatg gagcagcaac cctgagtccc
601 taaaggcagc agctcaag
//