LOCUS BC067512 618 bp mRNA linear HUM 30-JUN-2004 DEFINITION Homo sapiens interleukin 23, alpha subunit p19, mRNA (cDNA clone MGC:79392 IMAGE:6971852), complete cds. ACCESSION BC067512 VERSION BC067512.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 618) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 618) AUTHORS Strausberg,R. TITLE Direct Submission JOURNAL Submitted (19-MAR-2004) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: Narayan Bhat cDNA Library Preparation: Bhat Laboratory cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAK Plate: 172 Row: d Column: 17 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 28144902. FEATURES Location/Qualifiers source 1..618 /db_xref="H-InvDB:HIT000262670" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:79392 IMAGE:6971852" /tissue_type="PCR rescued clones" /clone_lib="NIH_MGC_195" /lab_host="DH10B" /note="Vector: pDNR-Dual" gene 1..618 /gene="IL23A" /gene_synonym="IL-23" /gene_synonym="IL-23A" /gene_synonym="IL23P19" /gene_synonym="P19" /gene_synonym="SGRF" /db_xref="GeneID:51561" /db_xref="MIM:605580" CDS 34..603 /gene="IL23A" /gene_synonym="IL-23" /gene_synonym="IL-23A" /gene_synonym="IL23P19" /gene_synonym="P19" /gene_synonym="SGRF" /codon_start=1 /product="interleukin 23, alpha subunit p19, precursor" /protein_id="AAH67512.1" /db_xref="GeneID:51561" /db_xref="MIM:605580" /translation="MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLA WSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEK LLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLL LRFKILRSLQAFVAVAARVFAHGAATLSP" BASE COUNT 141 a 177 c 172 g 128 t ORIGIN 1 agagccagcc agatttgaga agaaggcaaa aagatgctgg ggagcagagc tgtaatgctg 61 ctgttgctgc tgccctggac agctcagggc agagctgtgc ctgggggcag cagccctgcc 121 tggactcagt gccagcagct ttcacagaag ctctgcacac tggcctggag tgcacatcca 181 ctagtgggac acatggatct aagagaagag ggagatgaag agactacaaa tgatgttccc 241 catatccagt gtggagatgg ctgtgacccc caaggactca gggacaacag tcagttctgc 301 ttgcaaagga tccaccaggg tctgattttt tatgagaagc tgctaggatc ggatattttc 361 acaggggagc cttctctgct ccctgatagc cctgtgggcc agcttcatgc ctccctactg 421 ggcctcagcc aactcctgca gcctgagggt caccactggg agactcagca gattccaagc 481 ctcagtccca gccagccatg gcagcgtctc cttctccgct tcaaaatcct tcgcagcctc 541 caggcctttg tggctgtagc cgcccgggtc tttgcccatg gagcagcaac cctgagtccc 601 taaaggcagc agctcaag //