LOCUS BC066331 789 bp mRNA linear HUM 02-MAR-2004
DEFINITION Homo sapiens coiled-coil-helix-coiled-coil-helix domain containing
2, mRNA (cDNA clone MGC:87328 IMAGE:4792941), complete cds.
ACCESSION BC066331
VERSION BC066331.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 789)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 789)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (03-FEB-2004) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Miklos Palkovits, M.D., Ph.D.
cDNA Library Preparation: Michael J. Brownstein (NHGRI) & Shiraki
Toshiyuki and Piero Carninci (RIKEN)
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAK Plate: 167 Row: b Column: 7
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 7705850.
FEATURES Location/Qualifiers
source 1..789
/db_xref="H-InvDB:HIT000262222"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:87328 IMAGE:4792941"
/tissue_type="Brain, hypothalamus"
/clone_lib="NIH_MGC_96"
/lab_host="DH10B"
/note="Vector: pBluescript"
gene 1..789
/gene="CHCHD2"
/gene_synonym="C7orf17"
/db_xref="GeneID:51142"
CDS 41..496
/gene="CHCHD2"
/gene_synonym="C7orf17"
/codon_start=1
/product="CHCHD2 protein"
/protein_id="AAH66331.1"
/db_xref="GeneID:51142"
/translation="MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVG
SSAAAPRQPVLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEP
QGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA"
misc_feature 380..481
/gene="CHCHD2"
/gene_synonym="C7orf17"
/note="CHCH; Region: CHCH domain. we have identified a
conserved motif in the LOC118487 protein that we have
called the CHCH motif. Alignment of this protein with
related members showed the presence of three subgroups of
proteins, which are called the S (Small), N (N-terminal
extended) and C (C-terminal extended) subgroups. All three
sub-groups of proteins have in common that they contain a
predicted conserved [coiled coil 1]-[helix 1]-[coiled coil
2]-[helix 2] domain (CHCH domain). Within each helix of
the CHCH domain, there are two cysteines present in a
C-X9-C motif. The N-group contains an additional double
helix domain, and each helix contains the C-X9-C motif.
This family contains a number of characterised proteins:
Cox19 protein - a nuclear gene of Saccharomyces
cerevisiae, codes for an 11-kDa protein (Cox19p) required
for expression of cytochrome oxidase. Because cox19
mutants are able to synthesise the mitochondrial and
nuclear gene products of cytochrome oxidase, Cox19p
probably functions post-translationally during assembly of
the enzyme. Cox19p is present in the cytoplasm and
mitochondria, where it exists as a soluble intermembrane
protein. This dual location is similar to what was
previously reported for Cox17p, a low molecular weight
copper protein thought to be required for maturation of
the CuA centre of subunit 2 of cytochrome oxidase. Cox19p
have four conserved potential metal ligands, these are
three cysteines and one histidine. Mrp10 - belongs to the
class of yeast mitochondrial ribosomal proteins that are
essential for translation. Eukaryotic NADH-ubiquinone
oxidoreductase 19 kDa (NDUFA8) subunit"
/db_xref="CDD:pfam06747"
BASE COUNT 198 a 201 c 207 g 183 t
ORIGIN
1 gttgtcacac gtccggaggc ctagccgtcg cgtacctagg atgccgcgtg gaagccgaag
61 ccgcacctcc cgcatggccc ctccggccag ccgggcccct cagatgagag ctgcacccag
121 gccagcacca gtcgctcagc caccagcagc ggcaccccca tctgcagttg gctcttctgc
181 tgctgcgccc cggcagccag ttctgatggc ccagatggca accactgcag ctggcgtggc
241 tgtgggctct gctgtggggc acacattggg tcacgccatt actgggggct tcagtggagg
301 aagtaatgct gagcctgcga ggcctgacat cacttaccag gagcctcagg gaacccagcc
361 agcacagcag cagcagcctt gcctctatga gatcaaacag tttctggagt gtgcccagaa
421 ccagggtgac atcaagctct gtgagggttt caatgaggtg ctgaaacagt gccgacttgc
481 aaacggattg gcctaatgaa gaagttcaac ctggagagat ggaaaatcag ctctcataac
541 taagttaatt tagtataaaa atagaattga tagtgagggt ataaagtgta accatcagtt
601 aaacctctcc tgtcattcct agcttccttg cttcagaatt gaaatggaag tgggtgtccc
661 tactctgtag aatctgggac tgggcaaatg tttgtgtggc ctccttaaac tagctgttat
721 gttatgattt tattctttgt gagttaatta gaataaagtc attttcttcc aaggaaaaaa
781 aaaaaaaaa
//