LOCUS BC062701 1098 bp mRNA linear HUM 11-DEC-2003
DEFINITION Homo sapiens aquaporin 7, mRNA (cDNA clone MGC:71981
IMAGE:30324263), complete cds.
ACCESSION BC062701
VERSION BC062701.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1098)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1098)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (25-NOV-2003) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Dr. Michael Brownstein and Dr. Miklos Palkovits
cDNA Library Preparation: CLONTECH Laboratories, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Genome Sequence Centre,
BC Cancer Agency, Vancouver, BC, Canada
info@bcgsc.bc.ca
Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
George Yang, Scott Zuyderduyn, Marco Marra.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 51 Row: a Column: 10
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 4502186.
FEATURES Location/Qualifiers
source 1..1098
/db_xref="H-InvDB:HIT000260592"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:71981 IMAGE:30324263"
/tissue_type="Skin and meninges pool- skin, dura matter,
pia matter, choroid plexus."
/clone_lib="NIH_MGC_186"
/lab_host="DH10B"
/note="Vector: pDNR-LIB"
gene 1..1098
/gene="AQP7"
/gene_synonym="AQP7L"
/gene_synonym="AQP9"
/gene_synonym="AQPap"
/db_xref="GeneID:364"
/db_xref="MIM:602974"
CDS 216..866
/gene="AQP7"
/gene_synonym="AQP7L"
/gene_synonym="AQP9"
/gene_synonym="AQPap"
/codon_start=1
/product="AQP7 protein"
/protein_id="AAH62701.1"
/db_xref="GeneID:364"
/db_xref="MIM:602974"
/translation="MVLNKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFAN
CALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILHFSGGQLMVTGPVATAGIFA
TYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSL
GMNTGYAINPSRDLPPRIFTFIAGWGKQVFRWHHLPGLHWLHHPTGAPEIGGFCGV"
misc_feature 219..764
/gene="AQP7"
/gene_synonym="AQP7L"
/gene_synonym="AQP9"
/gene_synonym="AQPap"
/note="MIP; Region: Major intrinsic protein (MIP)
superfamily. Members of the MIP superfamily function as
membrane channels that selectively transport water, small
neutral molecules, and ions out of and between cells. The
channel proteins share a common fold: the N-terminal
cytosolic portion followed by six transmembrane helices,
which might have arisen through gene duplication. On the
basis of sequence similarity and functional
characteristics, the superfamily can be subdivided into
two major groups: water-selective channels called
aquaporins (AQPs) and glycerol uptake facilitators
(GlpFs). AQPs are found in all three kingdoms of life,
while GlpFs have been characterized only within
microorganisms"
/db_xref="CDD:cd00333"
BASE COUNT 260 a 312 c 287 g 239 t
ORIGIN
1 gggggacaca gggatagctg agccccagct gggggtggaa gctgagccag ggacagtcac
61 ggaggaacaa gatcaagatg cgctgtaact gagaagcccc caaggcggag gctgagaatc
121 agagacattt cagcagacat ctacaaatct gaaagacaaa acatggttca agcatccggg
181 cacaggcggt attcggcctt ggttccgtgg cccatatggt tctaaataaa aaatatggga
241 gctaccttgg tgtcaacttg ggttttggct tcggagtcac catgggagtg cacgtggcag
301 gccgcatctc tggagcccac atgaacgcag ctgtgacctt tgctaactgt gcgctgggcc
361 gcgtgccctg gaggaagttt ccggtctatg tgctggggca gttcctgggc tccttcctgg
421 cggctgccac catctacagt ctcttctaca cggccattct ccacttttcg ggtggacagc
481 tgatggtgac cggtcccgtc gctacagctg gcatttttgc cacctacctt cctgatcaca
541 tgacattgtg gcggggcttc ctgaatgagg cgtggctgac cgggatgctc cagctgtgtc
601 tcttcgccat cacggaccag gagaacaacc cagcactgcc aggaacagag gcgctggtga
661 taggcatcct cgtggtcatc atcggggtgt cccttggcat gaacacagga tatgccatca
721 acccgtcccg ggacctgccc ccccgcatct tcaccttcat tgctggttgg ggcaaacagg
781 tcttcaggtg gcatcatcta cctggtcttc attggctcca ccatcccacg ggagcccctg
841 aaattggagg attctgtggc gtatgaagac cacgggataa ccgtattgcc caagatggga
901 tctcatgaac ccacgatctc tcccctcacc cccgtctctg tgagccctgc caacagatct
961 tcagtccacc ctgccccacc cttacatgaa tccatggccc tagagcactt ctaagcagag
1021 attatttgtg atcccatcca ttccccaata aagcaaggct tgtccgtcaa aaaaaaaaaa
1081 aaaaaaaaaa aaaaaaaa
//