LOCUS BC047777 1882 bp mRNA linear HUM 24-FEB-2004
DEFINITION Homo sapiens zinc finger protein 554, mRNA (cDNA clone MGC:54281
IMAGE:6187000), complete cds.
ACCESSION BC047777
VERSION BC047777.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1882)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1882)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (03-MAR-2003) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: Dr. James R. Lupski
cDNA Library Preparation: Life Technologies, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAK Plate: 98 Row: l Column: 13
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 22748680.
FEATURES Location/Qualifiers
source 1..1882
/db_xref="H-InvDB:HIT000053253"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:54281 IMAGE:6187000"
/tissue_type="Peripheral Nervous System, sympathetic
trunk"
/clone_lib="Lupski_sympathetic_trunk"
/lab_host="DH10B"
/note="Vector: pCMV-SPORT6"
gene 1..1882
/gene="ZNF554"
/gene_synonym="FLJ34817"
/db_xref="GeneID:115196"
CDS 168..1784
/gene="ZNF554"
/gene_synonym="FLJ34817"
/codon_start=1
/product="ZNF554 protein"
/protein_id="AAH47777.1"
/db_xref="GeneID:115196"
/translation="MVTCAHLGRRARLPAAQPSACPGTCFSQEERMAAGYLPRWSQEL
VTFEDVSMDFSQEEWELLEPAQKNLYREVMLENYRNVVSLEALKNQCTDVGIKEGPLS
PAQTSQVTSLSSWTGYLLFQPVASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDST
YKKVALQEEPASGINMIKLIREDGGWKQLEDSHEDPQGLLSQKASLHVVAVPQEKATA
WHGFGENGNLSPALVLSQGSSKGNHLCGSELDITSLASDSVLNHHQLGYADRRPCESN
ECGNAIRQNSHFIQHGGKMFVYLENGQSLNHGMALTIHNKINTAEKPFECHQCGKVFN
RRHSLSEHQRIHTGEKPYECQECGRAFTHSSTLTRHLRTHTGEKPYGCGECGKAFNRI
SSLTQHQRIHTGEKPYKCEDCGKSFCQSSYLILHKRTHTGEKPYECSECGKAFSDRSS
LNQHERTHTGENPYECKQCGRAFSQRSSLVRHERTHTGEKPYRCQECGKAFSQSSSLV
THQKTHSSQKTYKIIDCGKAFYQNRHLIGY"
misc_feature 300..422
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="KRAB; Region: KRAB box. The KRAB domain (or
Kruppel-associated box) is present in about a third of
zinc finger proteins containing C2H2 fingers. The KRAB
domain is found to be involved in protein-protein
interactions. The KRAB domain is generally encoded by two
exons. The regions coded by the two exons are known as
KRAB-A and KRAB-B"
/db_xref="CDD:pfam01352"
misc_feature 1221..1289
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 1389..1457
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 1473..1541
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 1641..1709
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
BASE COUNT 516 a 472 c 519 g 375 t
ORIGIN
1 gcggcggctg cggcgagttc ctgaggggcg cctgcggggg gcgtccgctc cgagcgccga
61 ggggccgagc ggaggaggcg tcccagggac acgcagggga ggccggccgg cctgcacggg
121 gcgctcccgc ctcgggggcc ctgtctggcg cctcagcgcg cgccccgatg gtcacctgcg
181 cccacctggg ccggcgcgcg cgactcccgg cagctcagcc ctctgcctgc ccaggaacct
241 gcttttccca agaggagaga atggctgctg ggtacctgcc ccgctggtcc caggaattag
301 taacctttga ggacgtgtcc atggacttct cccaggagga gtgggagttg ctggagcctg
361 ctcagaagaa cctgtacaga gaggtgatgc tggagaacta caggaacgtg gtctccctgg
421 aagccttgaa gaaccaatgt actgatgtgg ggattaaaga gggtccactt tccccagcac
481 aaacctcaca agtcactagt ctttcctcat ggacggggta tttacttttt caaccagtgg
541 cttcttccca cttggagcaa agagaagccc tgtggataga ggaaaaagga actcctcaag
601 cctcctgttc agattggatg actgtactaa gaaaccaaga ctcaacttac aagaaggtgg
661 ctttgcagga ggaaccagcc agtggtataa atatgataaa gcttatcaga gaagatgggg
721 gatggaagca gttagaggac agccatgaag acccccaggg gcttttgagc caaaaggcat
781 cccttcacgt agtggccgtt cctcaggaga aggctactgc atggcatgga tttggggaaa
841 atggtaatct gagcccagcc cttgttttat cacagggaag ctctaaaggg aaccacttgt
901 gtggcagcga gttagatatt acaagcttgg catccgattc agtcttaaac caccatcagc
961 tgggatatgc agatcggaga ccttgtgaaa gtaatgaatg tggaaatgcc atccgccaga
1021 acagtcactt tattcaacac ggggggaaga tgtttgtgta tttggaaaat gggcagtcat
1081 tgaaccacgg tatggccctg actatccaca acaaaatcaa cacggcagag aaaccctttg
1141 agtgccacca gtgtgggaag gtgttcaacc ggaggcattc tttgagcgaa catcaaagaa
1201 ttcacacggg ggagaaaccc tacgagtgtc aggagtgtgg gcgagccttt acgcacagct
1261 ccaccctcac gcgccatctg agaactcata ctggagagaa gccctacggg tgcggtgagt
1321 gcgggaaagc cttcaacagg atctcatcgc tgactcagca tcagaggatt cacaccgggg
1381 aaaagcccta taaatgtgaa gactgtggga aatccttctg ccagagctct tacctgatct
1441 tgcacaagag gacacacacc ggagagaagc cctacgaatg cagtgaatgt ggaaaggcct
1501 tcagtgaccg ttcctctctc aaccagcacg agcgaactca cacgggcgag aacccctatg
1561 aatgtaagca gtgtgggaga gccttcagcc agaggtcttc ccttgtgagg cacgagagaa
1621 ctcacactgg agagaaaccc tacaggtgtc aggaatgtgg gaaagccttc agccagagct
1681 catcccttgt cacacatcag aaaactcaca gcagccagaa aacctataaa atcattgact
1741 gcgggaaagc gttctaccag aacagacatc ttattggata ttagcaattg cacgctgctt
1801 tgtaagccac tttttagtac tctgacacat acatgtggtt atcttttaaa aaaaaaaaaa
1861 aaaaaaaaaa aaaaaaaaaa aa
//