LOCUS       BC034152                 682 bp    mRNA    linear   HUM 08-JUL-2002
DEFINITION  Homo sapiens, Similar to hypothetical protein FLJ13102, clone
            IMAGE:4693100, mRNA, partial cds.
ACCESSION   BC034152
VERSION     BC034152.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 682)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: CLONTECH
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 41 Row: j Column: 17.
FEATURES             Location/Qualifiers
     source          1..682
                     /db_xref="H-InvDB:HIT000093349"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4693100"
                     /tissue_type="Lung"
                     /clone_lib="NIH_MGC_77"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     CDS             <1..377
                     /codon_start=3
                     /product="Similar to hypothetical protein FLJ13102"
                     /protein_id="AAH34152.1"
                     /translation="VRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSV
                     LQKARDMYAEERKRQQLERDQATETEQLLREGLQASGDAQLRRTRLHKLSARREERVQ
                     GFLQALELKRADWLARLGTASA"
BASE COUNT          167 a          189 c          191 g          135 t
ORIGIN      
        1 aagtgcggct gagtgacttc ttgctatggc agacctctca ctcctgcctg gtgttccaac
       61 ccgttctgtg gccagagtat acattttgga acctcttcga ggccatcctg cagttccaga
      121 tgaaccatag cgtgcttcag aaggcccgag acatgtatgc agaggagcgg aagaggcagc
      181 agctggagag ggaccaggct acagagacag agcagctgct gcgagagggg ctccaagcca
      241 gtggggacgc ccagctccga aggacacgct tgcacaaact ctcggccaga cgggaagagc
      301 gagtccaagg cttcctgcag gccttggaac tcaagcgagc tgactggctg gcccgtctgg
      361 gcactgcatc agcctgaatg aggctggcca cctgccactt tgccctgccc tctgcctcca
      421 gggctccact ccccttcctt ttcttggtga aaggcacctc ctttcctgat aatgaatggt
      481 gttccctttg cttggctggg gagcccccca ggccaggttt gctggccata gatacctttg
      541 ggctgcctgg gacaggctcc tgaggaggat tgagggtgaa agtctcccac gagtacacta
      601 aacctaggtc tggtcaccaa tagggtttgg agagcaaagg gccacaactc accaaaaaaa
      661 aaaaaaaaaa aaaaaaaaaa aa
//