LOCUS       BC020925                 719 bp    mRNA    linear   HUM 09-JUN-2008
DEFINITION  Homo sapiens solute carrier family 38, member 10, mRNA (cDNA clone
            IMAGE:4248198), partial cds.
ACCESSION   BC020925
VERSION     BC020925.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 719)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 719)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JAN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: CLONTECH
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 35 Row: c Column: 21.
FEATURES             Location/Qualifiers
     source          1..719
                     /db_xref="H-InvDB:HIT000090310"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4248198"
                     /tissue_type="Prostate"
                     /clone_lib="NIH_MGC_83"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            <1..719
                     /gene="SLC38A10"
                     /gene_synonym="PP1744"
                     /db_xref="GeneID:124565"
                     /db_xref="HGNC:HGNC:28237"
     CDS             <1..340
                     /gene="SLC38A10"
                     /gene_synonym="PP1744"
                     /codon_start=2
                     /product="SLC38A10 protein"
                     /protein_id="AAH20925.1"
                     /db_xref="GeneID:124565"
                     /db_xref="HGNC:HGNC:28237"
                     /translation="PHVEMCLVCLAEPFQALLSRRVVEEISHFKTFCFSFVQQKDGTF
                     AAGGYMPPLRFKALTLSVVFGTMVGGILIPNGKAGGLPCCRGVGPGASASTKTCTVTR
                     PAQRPSSLVS"
BASE COUNT          188 a          166 c          199 g          166 t
ORIGIN      
        1 gcctcacgtg gagatgtgcc tggtgtgcct ggcagagccc tttcaggctt tgctttctag
       61 gagagtggtg gaggaaatca gtcatttcaa aaccttttgt ttttcttttg tacagcaaaa
      121 agatggcacc tttgcagcag ggggctacat gccccctctc cggtttaaag cacttaccct
      181 ctctgtggtg tttggaacca tggttggtgg catccttatc cccaacggta aggcgggagg
      241 gctgccctgt tgccggggag tgggacccgg ggcttcggca tcaaccaaga cctgcacagt
      301 tacgagacct gcacagagac catcttctct ggtctcttaa aaaagtctag agactttgtc
      361 agtttttctc tggcccacag agaaaggcag gggataaaat ctggcaactt gagccaggtg
      421 cggtggctca cacctgtaat cccagcactt tgggaggttg aggtgggtgg atcacctggg
      481 gttgggagtt caagaccagc ctgaccaatg tggagaagcc ccgtctctac taaaaataca
      541 aaattagcag ggcgtcatgg tgcatgcctg taatcctagc tacttgggag gctgaggcaa
      601 aagaatcact tgaacccggg aggaggagtt tgcagtgagc caagattgcg ccattgcact
      661 ccaggctggg caacaagaga gaaacttcgt ctcaaaaaaa aaaaaaaaaa aaaaaaaaa
//