LOCUS       BC017761                 527 bp    mRNA    linear   HUM 09-MAY-2005
DEFINITION  Homo sapiens chromosome 1 open reading frame 54, mRNA (cDNA clone
            MGC:22166 IMAGE:4617936), complete cds.
ACCESSION   BC017761
VERSION     BC017761.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 527)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 527)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: CLONTECH
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 36 Row: h Column: 12
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 13375757.
FEATURES             Location/Qualifiers
     source          1..527
                     /db_xref="H-InvDB:HIT000038117"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:22166 IMAGE:4617936"
                     /tissue_type="Lung"
                     /clone_lib="NIH_MGC_77"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..527
                     /gene="C1orf54"
                     /gene_synonym="FLJ23221"
                     /db_xref="GeneID:79630"
     CDS             24..419
                     /gene="C1orf54"
                     /gene_synonym="FLJ23221"
                     /codon_start=1
                     /product="C1orf54 protein"
                     /protein_id="AAH17761.1"
                     /db_xref="GeneID:79630"
                     /translation="MDVLFVAIFAVPLILGQEYEDEERLGEDEYYQVVYYYTVTPSYD
                     DFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSP
                     DLNDAVSSLRSPIPLLLSCAFVQVGMYFM"
BASE COUNT          180 a           96 c          123 g          128 t
ORIGIN      
        1 acagcaatag tgcagaatcc agaatggatg tcctctttgt agccatcttt gctgtgccac
       61 ttatcctggg acaagaatat gaggatgaag aaagactggg agaggatgaa tattatcagg
      121 tggtctatta ttatacagtc acccccagtt atgatgactt tagtgcagat ttcaccattg
      181 attactccat atttgagtca gaggacaggc tgaacaggtt ggataaggac ataacagaag
      241 caatagagac taccattagt cttgaaacag cacgtgcaga ccatccgaag cctgtaactg
      301 tgaaaccagt aacaacggaa cctagcccag atctgaacga tgccgtgtcc agtttgcgaa
      361 gtcctattcc cctcctcctg tcgtgtgcct ttgttcaggt ggggatgtat ttcatgtaga
      421 aggtggaaga aggctgctat gactctttgg atgggagtct ggcaagagga aattggaaga
      481 taaaataaat aataagcaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa
//