LOCUS       BC017660                 670 bp    mRNA    linear   HUM 03-OCT-2003
DEFINITION  Homo sapiens chromosome 6 open reading frame 48, mRNA (cDNA clone
            MGC:14608 IMAGE:4049404), complete cds.
ACCESSION   BC017660
VERSION     BC017660.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 670)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 670)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 21 Row: k Column: 9.
FEATURES             Location/Qualifiers
     source          1..670
                     /db_xref="H-InvDB:HIT000038070_08"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:14608 IMAGE:4049404"
                     /tissue_type="Brain, primitive neuroectodermal"
                     /clone_lib="NIH_MGC_56"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..670
                     /gene="C6orf48"
                     /gene_synonym="D6S57"
                     /gene_synonym="G8"
                     /db_xref="GeneID:50854"
                     /db_xref="MIM:605447"
     CDS             319..546
                     /gene="C6orf48"
                     /gene_synonym="D6S57"
                     /gene_synonym="G8"
                     /codon_start=1
                     /product="C6orf48 protein"
                     /protein_id="AAH17660.1"
                     /db_xref="GeneID:50854"
                     /db_xref="MIM:605447"
                     /translation="MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLP
                     PGAGHILRTYNFPVLSCVSSCHLIGGKMPEN"
BASE COUNT          182 a          150 c          162 g          176 t
ORIGIN      
        1 ccccaacccg gcgccgccat aaatggcggc gccgggttgg ggtaggagag ggcggccccc
       61 agtgcagttg ggtgaactac cgttgcacac tggagtttct ggtgtctttg cttggaactg
      121 acctagctcg tggcaggggg aactcggcta gcggccccac agcccctgct gactcaaaac
      181 aactgagttg taggacgttc atcgccgtgt tatccttgag taaagaatga actctggaag
      241 cccagccagg gacaatgcac cttcacagag attctgcact aatctgagtg aaggtctaag
      301 gtttggaatc tccccctcat ggagagaagc tttgtatggc tgtcatgctt agacagtgat
      361 tcctgcaact tgaccttcag gctgggagag gtggagagcc atgcctgttc tccttccttg
      421 ctatggaatt tgctgacaca atatcttccg cctggtgctg ggcatatcct aagaacttac
      481 aactttcctg tattatcctg tgtgagcagc tgtcacctta ttgggggaaa aatgcctgaa
      541 aattaggggg cacttcaagt agatagcttc tatttcctat atttgtctta tatataagta
      601 tttgctttta tcaaaataat tccaataaag cattttaaag taaaaaaaaa aaaaaaaaaa
      661 aaaaaaaaaa
//