LOCUS BC017660 670 bp mRNA linear HUM 03-OCT-2003 DEFINITION Homo sapiens chromosome 6 open reading frame 48, mRNA (cDNA clone MGC:14608 IMAGE:4049404), complete cds. ACCESSION BC017660 VERSION BC017660.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 670) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 670) AUTHORS Strausberg,R. TITLE Direct Submission JOURNAL Submitted (03-DEC-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC cDNA Library Preparation: CLONTECH Laboratories, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 21 Row: k Column: 9. FEATURES Location/Qualifiers source 1..670 /db_xref="H-InvDB:HIT000038070_08" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:14608 IMAGE:4049404" /tissue_type="Brain, primitive neuroectodermal" /clone_lib="NIH_MGC_56" /lab_host="DH10B" /note="Vector: pDNR-LIB" gene 1..670 /gene="C6orf48" /gene_synonym="D6S57" /gene_synonym="G8" /db_xref="GeneID:50854" /db_xref="MIM:605447" CDS 319..546 /gene="C6orf48" /gene_synonym="D6S57" /gene_synonym="G8" /codon_start=1 /product="C6orf48 protein" /protein_id="AAH17660.1" /db_xref="GeneID:50854" /db_xref="MIM:605447" /translation="MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLP PGAGHILRTYNFPVLSCVSSCHLIGGKMPEN" BASE COUNT 182 a 150 c 162 g 176 t ORIGIN 1 ccccaacccg gcgccgccat aaatggcggc gccgggttgg ggtaggagag ggcggccccc 61 agtgcagttg ggtgaactac cgttgcacac tggagtttct ggtgtctttg cttggaactg 121 acctagctcg tggcaggggg aactcggcta gcggccccac agcccctgct gactcaaaac 181 aactgagttg taggacgttc atcgccgtgt tatccttgag taaagaatga actctggaag 241 cccagccagg gacaatgcac cttcacagag attctgcact aatctgagtg aaggtctaag 301 gtttggaatc tccccctcat ggagagaagc tttgtatggc tgtcatgctt agacagtgat 361 tcctgcaact tgaccttcag gctgggagag gtggagagcc atgcctgttc tccttccttg 421 ctatggaatt tgctgacaca atatcttccg cctggtgctg ggcatatcct aagaacttac 481 aactttcctg tattatcctg tgtgagcagc tgtcacctta ttgggggaaa aatgcctgaa 541 aattaggggg cacttcaagt agatagcttc tatttcctat atttgtctta tatataagta 601 tttgctttta tcaaaataat tccaataaag cattttaaag taaaaaaaaa aaaaaaaaaa 661 aaaaaaaaaa //