LOCUS BC017018 1120 bp mRNA linear HUM 26-APR-2004
DEFINITION Homo sapiens DnaJ (Hsp40) homolog, subfamily C, member 12, mRNA
(cDNA clone MGC:8921 IMAGE:3884093), complete cds.
ACCESSION BC017018
VERSION BC017018.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1120)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1120)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (05-NOV-2001) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: DCTD/DTP/Gazdar
cDNA Library Preparation: Life Technologies, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAK Plate: 22 Row: b Column: 21
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 11141870.
FEATURES Location/Qualifiers
source 1..1120
/db_xref="H-InvDB:HIT000037788"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:8921 IMAGE:3884093"
/tissue_type="Lung, large cell carcinoma"
/clone_lib="NIH_MGC_68"
/lab_host="DH10B"
/note="Vector: pCMV-SPORT6"
gene 1..1120
/gene="DNAJC12"
/gene_synonym="JDP1"
/db_xref="GeneID:56521"
/db_xref="MIM:606060"
CDS 105..701
/gene="DNAJC12"
/gene_synonym="JDP1"
/codon_start=1
/product="DNAJC12 protein"
/protein_id="AAH17018.1"
/db_xref="GeneID:56521"
/db_xref="MIM:606060"
/translation="MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPD
KHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSMH
WVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEELASTAEKTEQKEPKPLEKSVS
PQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI"
misc_feature 144..341
/gene="DNAJC12"
/gene_synonym="JDP1"
/note="DnaJ; Region: DnaJ domain. DnaJ domains (J-domains)
are associated with hsp70 heat-shock system and it is
thought that this domain mediates the interaction.
DnaJ-domain is therefore part of a chaperone (protein
folding) system. The T-antigens are confirmed as DnaJ
containing domains from literature"
/db_xref="CDD:pfam00226"
BASE COUNT 382 a 208 c 231 g 299 t
ORIGIN
1 ggaacatgct gctctaattc agatttaaag agtttcttcc tgttaattcg aagctcactg
61 tgcctcttgt ttccgaggga agaaggactg attaagtcat ctaaatggat gcaatactga
121 attacaggtc agaagatact gaagattact acacattact gggatgtgat gaactatctt
181 cggttgaaca aatcctggca gaatttaaag tcagagctct ggaatgtcac ccagacaagc
241 atcctgaaaa ccccaaagct gtggagactt ttcagaaact gcagaaggca aaggagattc
301 tgaccaatga agagagtcga gcccgctatg accactggcg aaggagccag atgtcgatgc
361 cattccagca gtgggaagct ttgaatgact cagtgaagac gtcaatgcac tgggttgtca
421 gaggtaaaaa agacctgatg ctggaagaat ctgacaagac tcataccacc aagatggaaa
481 atgaggaatg taatgagcaa agagaaagaa agaaagagga gctggcttca accgcagaga
541 aaacggagca gaaagaaccc aagcccctag agaagtcagt ctccccgcaa aattcagatt
601 cttcaggttt tgcagatgtg aatggttggc accttcgttt ccgctggtcc aaggatgctc
661 cctcagaact cctgaggaag ttcagaaact atgaaatatg aaatatctct gcttcaaaaa
721 atgaggaaga gcaagactgt cccctatgct gccaacatgc agtctttgtt tatgtcttaa
781 aaatgtcatg tttatgtcat gtctgtgaat tgctgagtac taattgattc ctccatcctt
841 gaatcagttc tcataatgct ttttaaataa gaaaaattca gaagatgaat ttcttccaat
901 atttgaataa attaaagctc ttagatacag agtagattgt attatatgct ttttcctatt
961 aatactactt atagaaatcc attaaaaagc aatctctgta cagtgtattt aaatatttca
1021 ttgacatact gtgatctcta caatgaaatg tgaaattact tgtctgaacc ccgtggggag
1081 aaataaataa ttttcccaaa gttcaaaaaa aaaaaaaaaa
//