LOCUS BC014522 877 bp mRNA linear HUM 15-JUL-2006 DEFINITION Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 14B, mRNA (cDNA clone MGC:11098 IMAGE:3831227), complete cds. ACCESSION BC014522 VERSION BC014522.2 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 877) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. CONSRTM Mammalian Gene Collection Program Team TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 877) CONSRTM NIH MGC Project TITLE Direct Submission JOURNAL Submitted (24-SEP-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT On Aug 20, 2003 this sequence version replaced BC014522.1. Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC/DCTD/DTP cDNA Library Preparation: Rubin Laboratory cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Institute for Systems Biology http://www.systemsbiology.org contact: amadan@systemsbiology.org Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 14 Row: h Column: 7. FEATURES Location/Qualifiers source 1..877 /db_xref="H-InvDB:HIT000036754" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:11098 IMAGE:3831227" /tissue_type="Skin, melanotic melanoma." /clone_lib="NIH_MGC_20" /lab_host="DH10B-R" /note="Vector: pOTB7" gene 1..877 /gene="PPP1R14B" /gene_synonym="PHI-1" /gene_synonym="PNG" /gene_synonym="SOM172" /db_xref="GeneID:26472" /db_xref="HGNC:HGNC:9057" /db_xref="MIM:601140" CDS 121..564 /gene="PPP1R14B" /gene_synonym="PHI-1" /gene_synonym="PNG" /gene_synonym="SOM172" /codon_start=1 /product="protein phosphatase 1, regulatory (inhibitor) subunit 14B" /protein_id="AAH14522.3" /db_xref="GeneID:26472" /db_xref="HGNC:HGNC:9057" /db_xref="MIM:601140" /translation="MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGA DDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLD MESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK" BASE COUNT 197 a 259 c 288 g 133 t ORIGIN 1 ccctcgccgc ggagccgcgc ggagcggagc cggcgagcta acccgagcca gccggcgggc 61 gtcccggagg cggtggcgca gggaggggcc cgacgctcgc acgtggcccc ggcggccgcc 121 atggcggaca gcggcaccgc ggggggcgcg gcgttggcgg ccccggcccc cgggccgggc 181 agtggcggcc caggaccacg cgtctacttt cagagccccc ccggggccgc aggagagggc 241 ccgggcgggg cggacgatga gggcccagtg aggcgccaag ggaaggtcac cgtcaagtat 301 gaccgcaagg agctacggaa gcgcctcaac ctagaggagt ggatcctgga gcagctcacg 361 cgcctctacg actgccagga agaggagatc ccagaactgg agattgacgt ggatgagctc 421 ctggacatgg agagtgacga tgcccgggct gccagggtca aggagctgct ggttgactgt 481 tacaaaccca cagaggcctt catttctggc ctgctggaca agatccgggg catgcagaag 541 ctgagcacac cccagaagaa gtgagggtcc ccgacccagg agaacggtgg ctcccacagg 601 acaatcgctg ccccccaacc tcgtagcaac agcaataccg ggggaccctg cggccaggcc 661 tggtgccatg agcagggctc ctcgtgcccc tggcccaggg gtctcttccc ctgccccctc 721 agttttccac ttttggggtt ttttattgtt attaaactga tgggactttt tgtgttttta 781 tattgactct gcggcgcggg ccctttaata aagctaggat acgcctttgg tgcaaaaaaa 841 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa //