LOCUS       BC014522                 877 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit
            14B, mRNA (cDNA clone MGC:11098 IMAGE:3831227), complete cds.
ACCESSION   BC014522
VERSION     BC014522.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 877)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 877)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (24-SEP-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 20, 2003 this sequence version replaced BC014522.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 14 Row: h Column: 7.
FEATURES             Location/Qualifiers
     source          1..877
                     /db_xref="H-InvDB:HIT000036754"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:11098 IMAGE:3831227"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_20"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..877
                     /gene="PPP1R14B"
                     /gene_synonym="PHI-1"
                     /gene_synonym="PNG"
                     /gene_synonym="SOM172"
                     /db_xref="GeneID:26472"
                     /db_xref="HGNC:HGNC:9057"
                     /db_xref="MIM:601140"
     CDS             121..564
                     /gene="PPP1R14B"
                     /gene_synonym="PHI-1"
                     /gene_synonym="PNG"
                     /gene_synonym="SOM172"
                     /codon_start=1
                     /product="protein phosphatase 1, regulatory (inhibitor)
                     subunit 14B"
                     /protein_id="AAH14522.3"
                     /db_xref="GeneID:26472"
                     /db_xref="HGNC:HGNC:9057"
                     /db_xref="MIM:601140"
                     /translation="MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGA
                     DDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLD
                     MESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK"
BASE COUNT          197 a          259 c          288 g          133 t
ORIGIN      
        1 ccctcgccgc ggagccgcgc ggagcggagc cggcgagcta acccgagcca gccggcgggc
       61 gtcccggagg cggtggcgca gggaggggcc cgacgctcgc acgtggcccc ggcggccgcc
      121 atggcggaca gcggcaccgc ggggggcgcg gcgttggcgg ccccggcccc cgggccgggc
      181 agtggcggcc caggaccacg cgtctacttt cagagccccc ccggggccgc aggagagggc
      241 ccgggcgggg cggacgatga gggcccagtg aggcgccaag ggaaggtcac cgtcaagtat
      301 gaccgcaagg agctacggaa gcgcctcaac ctagaggagt ggatcctgga gcagctcacg
      361 cgcctctacg actgccagga agaggagatc ccagaactgg agattgacgt ggatgagctc
      421 ctggacatgg agagtgacga tgcccgggct gccagggtca aggagctgct ggttgactgt
      481 tacaaaccca cagaggcctt catttctggc ctgctggaca agatccgggg catgcagaag
      541 ctgagcacac cccagaagaa gtgagggtcc ccgacccagg agaacggtgg ctcccacagg
      601 acaatcgctg ccccccaacc tcgtagcaac agcaataccg ggggaccctg cggccaggcc
      661 tggtgccatg agcagggctc ctcgtgcccc tggcccaggg gtctcttccc ctgccccctc
      721 agttttccac ttttggggtt ttttattgtt attaaactga tgggactttt tgtgttttta
      781 tattgactct gcggcgcggg ccctttaata aagctaggat acgcctttgg tgcaaaaaaa
      841 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa
//