LOCUS BC009756 1635 bp mRNA linear HUM 24-FEB-2004
DEFINITION Homo sapiens pyridoxal (pyridoxine, vitamin B6) phosphatase, mRNA
(cDNA clone IMAGE:3840432), partial cds.
ACCESSION BC009756
VERSION BC009756.2
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1635)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1635)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (02-JUL-2001) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT On Dec 9, 2003 this sequence version replaced BC009756.1.
Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: ATCC
cDNA Library Preparation: Rubin Laboratory
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Institute for Systems Biology
http://www.systemsbiology.org
contact: amadan@systemsbiology.org
Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 14 Row: m Column: 6
This clone was selected for full length sequencing because it
passed the following selection criteria: Hexamer frequency ORF
analysis.
FEATURES Location/Qualifiers
source 1..1635
/db_xref="H-InvDB:HIT000087376"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:3840432"
/tissue_type="Placenta, choriocarcinoma"
/clone_lib="NIH_MGC_21"
/lab_host="DH10B-R"
/note="Vector: pOTB7"
gene <1..1635
/gene="PDXP"
/gene_synonym="dJ37E16.5"
/gene_synonym="PLP"
/db_xref="GeneID:57026"
CDS <1..533
/gene="PDXP"
/gene_synonym="dJ37E16.5"
/gene_synonym="PLP"
/codon_start=3
/product="PDXP protein"
/protein_id="AAH09756.2"
/db_xref="GeneID:57026"
/translation="ELRAAGLRLAGDPSAGDGAAPRVRAVLVGYDEHFSFAKLREACA
HLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECI
TENFSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVP
HYYVESIADLTEGLED"
misc_feature 66..422
/gene="PDXP"
/gene_synonym="dJ37E16.5"
/gene_synonym="PLP"
/note="Hydrolase; Region: haloacid dehalogenase-like
hydrolase. This family are structurally different from the
alpha/ beta hydrolase family (pfam00561). This family
includes L-2-haloacid dehalogenase, epoxide hydrolases and
phosphatases. The structure of the family consists of two
domains. One is an inserted four helix bundle, which is
the least well conserved region of the alignment. The rest
of the fold is composed of the core alpha/beta domain"
/db_xref="CDD:pfam00702"
BASE COUNT 318 a 513 c 458 g 346 t
ORIGIN
1 ccgagctgcg cgccgcgggg ctgcgcctgg ccggggaccc gagcgcgggg gacggcgcgg
61 ccccgcgcgt gcgcgccgtg cttgtgggct acgacgagca cttctccttc gccaagctga
121 gggaggcgtg cgcgcacctg cgcgaccccg agtgcctact cgtggccacc gaccgtgacc
181 catggcaccc gctgagcgac ggcagccgga cccctggcac cgggagcctg gccgctgcag
241 tggagacagc ctcgggacgc caggccctgg tggtgggcaa gcccagcccc tacatgttcg
301 agtgcatcac ggagaacttc agcatcgacc ccgcacgcac gcttatggtg ggtgaccgcc
361 tggagaccga catcctcttt ggccaccgct gcggcatgac cactgtgctc acgctcacag
421 gagtctcccg cctagaagag gcccaggcct acctagcggc cggccagcac gacctcgtgc
481 cccattacta tgtggagagc atcgcagact tgacagaggg gttggaggac tgagcccact
541 gcacctgcag ccacaggccc acccctcccc actccctgat cccgtaggtg gaggcgatgg
601 gtcacgagcc atgttaagca caaccggctc cttggtccag ttctgcaccg gggtggggct
661 gggacccggg gaaggtttga gggcccttgc aaccccctcc cagcagtggc tgggcactct
721 ttgctgcccc agaagctggt cccctatgga ttcatcttgg cctgacccag ccaggtggcc
781 ttatttcttc cctgtcacct cccctccttg aaatctgggc cctggtgcct gctgaagatt
841 ccctctatcc ctgagtactt agtcttctcc cccttccctg gggcttctag agctctctct
901 gcccctcagg tcctggccct tgggtccttg tcaaccagag gtctagggaa ccacaaccct
961 tattgtcctg ggtggaccaa tccaaaggct aagtgatagt gactcatcaa tgttgggtcc
1021 tgtggggtac cagtttaggt tcctaagtaa tagtgaccct ttcacgtcct ggagcccgag
1081 tggaccaatc ggaagcctaa gtgacgatga ccctcgcatg tcctaggtcc ctgggtggac
1141 ccatcaggac cccaagtgat agtgacccag tggtctttta gatcctcagt agaacagtcc
1201 agaagcctga gagacagtgg ccccttgata atttgggtct cacgggacca gctaggggtc
1261 caggtttcag tcagtaaata agagtggtcc acgtcctaaa gacacctctc ctttacaaag
1321 acttgtgatg ctctggggct tctgtggcca agccccaccc tttcctggtc atggtacccg
1381 tacagcgttg atggccacag ctcgaagggg ggctttcgtg tccccctgtg cggtcagtgt
1441 tttcagtacc acctctctcc catgcccact tggctattta cttatttatt tattgtgtgc
1501 cagtgatggt gggtgggggc tgggccttcc ccgccacctc cacccctgtt gtgacctgtc
1561 cttccgtact taataaagtg cgcgtgggag tgttaaaaaa aaaaaaaaaa aaaaaaaaaa
1621 aaaaaaaaaa aaaaa
//