LOCUS       BC009728                 361 bp    mRNA    linear   HUM 30-SEP-2003
DEFINITION  Homo sapiens paraoxonase 2, mRNA (cDNA clone IMAGE:3901231),
            partial cds.
ACCESSION   BC009728
VERSION     BC009728.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 361)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 361)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUN-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 25, 2003 this sequence version replaced BC009728.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 14 Row: n Column: 8
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4505952.
FEATURES             Location/Qualifiers
     source          1..361
                     /db_xref="H-InvDB:HIT000087368"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3901231"
                     /tissue_type="Pancreas, epithelioid carcinoma"
                     /clone_lib="NIH_MGC_70"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..>361
                     /gene="PON2"
                     /db_xref="GeneID:5445"
                     /db_xref="MIM:602447"
     CDS             78..>361
                     /gene="PON2"
                     /codon_start=1
                     /product="PON2 protein"
                     /protein_id="AAH09728.1"
                     /db_xref="GeneID:5445"
                     /db_xref="MIM:602447"
                     /translation="MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHL
                     IKGIEAGSEDIDILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKKKK"
     misc_feature    162..359
                     /gene="PON2"
                     /note="Arylesterase; Region: Arylesterase. This family
                     consists of arylesterases (Also known as serum
                     paraoxonase) EC:3.1.1.2. These enzymes hydrolyses
                     organophosphorus esters such as paraoxon and are found in
                     the liver and blood. They confer resistance to
                     organophosphate toxicity. Human arylesterase (PON1) is
                     associated with HDL and may protect against LDL oxidation"
                     /db_xref="CDD:pfam01731"
BASE COUNT           91 a           91 c          105 g           74 t
ORIGIN      
        1 atcgagccgg gaagatggca ccgcccacgg agctgctggc caggccggag cgaggcagcg
       61 cgcccggctc ccgcgccatg gggcggctgg tggctgtggg cttgctgggg atcgcgctgg
      121 cgctcctggg cgagaggctt ctggcactca gaaatcgact taaagcctcc agagaagtag
      181 aatctgtaga ccttccacac tgccacctga ttaaaggaat tgaagctggc tctgaagata
      241 ttgacatact tcccaatggt ctggcttttt ttagtgtggg tctaaaattc ccaggactcc
      301 acagctttgc accagataag cctggaggaa tactaatgat ggatctaaaa aaaaaaaaaa
      361 a
//