LOCUS       BC009544                1213 bp    mRNA    linear   HUM 22-OCT-2001
DEFINITION  Homo sapiens, clone IMAGE:3897065, mRNA, partial cds.
ACCESSION   BC009544
VERSION     BC009544.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1213)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUN-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 14 Row: i Column: 24
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis.
FEATURES             Location/Qualifiers
     source          1..1213
                     /db_xref="H-InvDB:HIT000087317"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3897065"
                     /tissue_type="Pancreas, epithelioid carcinoma"
                     /clone_lib="NIH_MGC_70"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     CDS             <1..481
                     /codon_start=2
                     /product="Unknown (protein for IMAGE:3897065)"
                     /protein_id="AAH09544.1"
                     /translation="CYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA
                     LFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT
                     ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF"
BASE COUNT          287 a          290 c          308 g          328 t
ORIGIN      
        1 gtgctacgtc gccctggact tcgagcagga gatggccacc gccgcatcct cctcttctct
       61 ggagaagagc tacgagctgc ccgatggcca ggtcatcacc attggcaatg agcggttccg
      121 gtgtccggag gcgctgttcc agccttcctt cctgggtatg gaatcttgcg gcatccacga
      181 gaccaccttc aactccatca tgaagtgtga cgtggacatc cgcaaagacc tgtacgccaa
      241 cacggtgctg tcgggcggca ccaccatgta tccgggcatt gctgacagga tgcagaagga
      301 gatcaccgcc ctggcgccca gcaccatgaa gatcaagatc atcgcacccc cagagcgcaa
      361 gtactcggtg tggatcggtg gctccatcct ggcctcactg tccaccttcc agcagatgtg
      421 gattagcaag caggagtacg acgagtcggg cccctccatc gtccaccgca aatgcttcta
      481 aacggactca gcagatgcgt agcatttgct gcatgggtta attgagaata gaaatttgcc
      541 cctggcaaat gcacacacct catgctagcc tcacgaaact ggaataagcc ttcgaaaaga
      601 aattgtcctt gaagcttgta tctgatatca gcactggatt gtagaacttg ttgctgattt
      661 tgaccttgta ttgaagttaa ctgttcccct tggtatttgt ttaataccct gtacatatct
      721 ttgagttcaa cctttagtac gtgtggcttg gtcacttcgt ggctaaggta agaacgtgct
      781 tgtggaagac aagtctgtgg cttggtgagt ctgtgtggcc agcagcctct gatctgtgca
      841 gggtattaac gtgtcagggc tgagtgttct gggatttctc tagaggctgg caagaaccag
      901 ttgttttgtc ttgcgggtct gtcagggttg gaaagtccaa gccgtaggac ccagtttcct
      961 ttcttagctg atgtctttgg ccagaacacc gtgggctgtt acttgctttg agttggaagc
     1021 ggtttgcatt tacgcctgta aatgtattca ttcttaattt atgtaaggtt ttttttgtac
     1081 gcaattctcg attctttgaa gagatgacaa caaattttgg ttttctactg ttatgtgaga
     1141 acattaggcc ccagcaacac gtcattgtgt aaggaaaaat aaaagtgctg ccgtaaccaa
     1201 aaaaaaaaaa aaa
//