LOCUS BC009544 1213 bp mRNA linear HUM 22-OCT-2001 DEFINITION Homo sapiens, clone IMAGE:3897065, mRNA, partial cds. ACCESSION BC009544 VERSION BC009544.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1213) AUTHORS Strausberg,R. TITLE Direct Submission JOURNAL Submitted (29-JUN-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC cDNA Library Preparation: Life Technologies, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAK Plate: 14 Row: i Column: 24 This clone was selected for full length sequencing because it passed the following selection criteria: Hexamer frequency ORF analysis. FEATURES Location/Qualifiers source 1..1213 /db_xref="H-InvDB:HIT000087317" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:3897065" /tissue_type="Pancreas, epithelioid carcinoma" /clone_lib="NIH_MGC_70" /lab_host="DH10B" /note="Vector: pCMV-SPORT6" CDS <1..481 /codon_start=2 /product="Unknown (protein for IMAGE:3897065)" /protein_id="AAH09544.1" /translation="CYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA LFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF" BASE COUNT 287 a 290 c 308 g 328 t ORIGIN 1 gtgctacgtc gccctggact tcgagcagga gatggccacc gccgcatcct cctcttctct 61 ggagaagagc tacgagctgc ccgatggcca ggtcatcacc attggcaatg agcggttccg 121 gtgtccggag gcgctgttcc agccttcctt cctgggtatg gaatcttgcg gcatccacga 181 gaccaccttc aactccatca tgaagtgtga cgtggacatc cgcaaagacc tgtacgccaa 241 cacggtgctg tcgggcggca ccaccatgta tccgggcatt gctgacagga tgcagaagga 301 gatcaccgcc ctggcgccca gcaccatgaa gatcaagatc atcgcacccc cagagcgcaa 361 gtactcggtg tggatcggtg gctccatcct ggcctcactg tccaccttcc agcagatgtg 421 gattagcaag caggagtacg acgagtcggg cccctccatc gtccaccgca aatgcttcta 481 aacggactca gcagatgcgt agcatttgct gcatgggtta attgagaata gaaatttgcc 541 cctggcaaat gcacacacct catgctagcc tcacgaaact ggaataagcc ttcgaaaaga 601 aattgtcctt gaagcttgta tctgatatca gcactggatt gtagaacttg ttgctgattt 661 tgaccttgta ttgaagttaa ctgttcccct tggtatttgt ttaataccct gtacatatct 721 ttgagttcaa cctttagtac gtgtggcttg gtcacttcgt ggctaaggta agaacgtgct 781 tgtggaagac aagtctgtgg cttggtgagt ctgtgtggcc agcagcctct gatctgtgca 841 gggtattaac gtgtcagggc tgagtgttct gggatttctc tagaggctgg caagaaccag 901 ttgttttgtc ttgcgggtct gtcagggttg gaaagtccaa gccgtaggac ccagtttcct 961 ttcttagctg atgtctttgg ccagaacacc gtgggctgtt acttgctttg agttggaagc 1021 ggtttgcatt tacgcctgta aatgtattca ttcttaattt atgtaaggtt ttttttgtac 1081 gcaattctcg attctttgaa gagatgacaa caaattttgg ttttctactg ttatgtgaga 1141 acattaggcc ccagcaacac gtcattgtgt aaggaaaaat aaaagtgctg ccgtaaccaa 1201 aaaaaaaaaa aaa //