LOCUS BC008950 769 bp mRNA linear HUM 31-OCT-2003
DEFINITION Homo sapiens Rab acceptor 1 (prenylated), mRNA (cDNA clone MGC:3593
IMAGE:2963628), complete cds.
ACCESSION BC008950
VERSION BC008950.2
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 769)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 769)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (29-MAY-2001) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT On Oct 31, 2003 this sequence version replaced BC008950.1.
Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: DCTD/DTP
cDNA Library Preparation: Rubin Laboratory
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Institute for Systems Biology
http://www.systemsbiology.org
contact: amadan@systemsbiology.org
Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 10 Row: p Column: 15
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 5453959.
FEATURES Location/Qualifiers
source 1..769
/db_xref="H-InvDB:HIT000034099"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:3593 IMAGE:2963628"
/tissue_type="Kidney, renal cell adenocarcinoma"
/clone_lib="NIH_MGC_14"
/lab_host="DH10B-R"
/note="Vector: pOTB7"
gene 1..769
/gene="RABAC1"
/gene_synonym="PRA1"
/db_xref="GeneID:10567"
/db_xref="MIM:604925"
CDS 37..594
/gene="RABAC1"
/gene_synonym="PRA1"
/codon_start=1
/product="RABAC1 protein"
/protein_id="AAH08950.1"
/db_xref="GeneID:10567"
/db_xref="MIM:604925"
/translation="MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRP
WSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAV
FFGACYILYLRTLESKLVLFGREVSPAHQYALAGGISFPFFWLAGAGSAVFWVLGATL
VVIGSHAAFHQIEAVDGEELQMEPV"
misc_feature 136..591
/gene="RABAC1"
/gene_synonym="PRA1"
/note="Region: PRA1 family protein. This family includes
the PRA1 (Prenylated rab acceptor) protein. This family
also includes the glutamate transporter EAAC1 interacting
protein GTRAP3-18"
/db_xref="CDD:pfam03208"
BASE COUNT 140 a 235 c 234 g 160 t
ORIGIN
1 gctggttaca gcagctctac ccctcacgac gcaaacatgg cagcgcagaa ggaccagcag
61 aaagatgccg aggcggaagg gctgagcggc acgaccctgc tgccgaagct gattccctcc
121 ggtgcaggcc gggagtggct ggagcggcgc cgcgcgacca tccggccctg gagcaccttc
181 gtggaccagc agcgcttctc acggccccgc aacctgggag agctgtgcca gcgcctcgta
241 cgcaacgtgg agtactacca gagcaactat gtgttcgtgt tcctgggcct catcctgtac
301 tgtgtggtga cgtcccctat gttgctggtg gctctggctg tctttttcgg cgcctgttac
361 attctctatc tgcgcacctt ggagtccaag cttgtgctct ttggccgaga ggtgagccca
421 gcgcatcagt atgctctggc tggaggcatc tccttcccct tcttctggct ggctggtgcg
481 ggctcggccg tcttctgggt gctgggagcc accctggtgg tcatcggctc ccacgctgcc
541 ttccaccaga ttgaggctgt ggacggggag gagctgcaga tggaacccgt gtgaggtgtc
601 ttctgggacc tgccggcctc ccgggccagc tctgcccatg cctgtcctgc acggctctgc
661 tgctcgggcc cacagcgccg tcccatcaca agcccgggga gggatcccgc ctttgaaaat
721 aaagctgtta tgggtgtcat tcagaaaaaa aaaaaaaaaa aaaaaaaaa
//