LOCUS BC007022 537 bp mRNA linear HUM 02-JAN-2004 DEFINITION Homo sapiens serum amyloid A1, mRNA (cDNA clone MGC:12369 IMAGE:4071612), complete cds. ACCESSION BC007022 VERSION BC007022.1 KEYWORDS MGC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 537) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 537) AUTHORS Strausberg,R. TITLE Direct Submission JOURNAL Submitted (30-APR-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: CLONTECH cDNA Library Preparation: CLONTECH Laboratories, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Sequencing Group at the Stanford Human Genome Center, Stanford University School of Medicine, Stanford, CA 94305 Web site: http://www-shgc.stanford.edu Contact: (Dickson, Mark) mcd@paxil.stanford.edu Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers, R. M. Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 16 Row: f Column: 22 This clone was selected for full length sequencing because it passed the following selection criteria: matched mRNA gi: 4506776. FEATURES Location/Qualifiers source 1..537 /db_xref="H-InvDB:HIT000032992" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="MGC:12369 IMAGE:4071612" /tissue_type="Liver" /clone_lib="NIH_MGC_76" /lab_host="DH10B" /note="Vector: pDNR-LIB" gene 1..537 /gene="SAA1" /gene_synonym="PIG4" /gene_synonym="SAA" /gene_synonym="TP53I4" /db_xref="GeneID:6288" /db_xref="MIM:104750" CDS 38..406 /gene="SAA1" /gene_synonym="PIG4" /gene_synonym="SAA" /gene_synonym="TP53I4" /codon_start=1 /product="SAA1 protein" /protein_id="AAH07022.1" /db_xref="GeneID:6288" /db_xref="MIM:104750" /translation="MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMRE ANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADE WGRSGKDPNHFRPAGLPEKY" misc_feature 95..403 /gene="SAA1" /gene_synonym="PIG4" /gene_synonym="SAA" /gene_synonym="TP53I4" /note="SAA_proteins; Region: Serum amyloid A protein" /db_xref="CDD:pfam00277" BASE COUNT 147 a 127 c 152 g 111 t ORIGIN 1 agggacccgc agctcagcta cagcacagat cagcaccatg aagcttctca cgggcctggt 61 tttctgctcc ttggtcctgg gtgtcagcag ccgaagcttc ttttcgttcc ttggcgaggc 121 ttttgatggg gctcgggaca tgtggagagc ctactctgac atgagagaag ccaattacat 181 cggctcagac aaatacttcc atgctcgggg gaactatgat gctgccaaaa ggggacctgg 241 gggtgtctgg gctgcagaag cgatcagcga tgccagagag aatatccaga gattctttgg 301 ccatggtgcg gaggactcac tggccgatca ggctgccgat gaatggggca ggagtggcaa 361 agaccccaat cacttccgac ctgctggcct gcctgagaaa tactgagctt cctcttcact 421 ctgctctcag gagatctggc tgtgaggccc tcagggcagg gatacaaagc ggggagaggg 481 tacacaatgg gtatctaata aatacttaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa //