LOCUS       BC007022                 537 bp    mRNA    linear   HUM 02-JAN-2004
DEFINITION  Homo sapiens serum amyloid A1, mRNA (cDNA clone MGC:12369
            IMAGE:4071612), complete cds.
ACCESSION   BC007022
VERSION     BC007022.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 537)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 537)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-APR-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: CLONTECH
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 16 Row: f Column: 22
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4506776.
FEATURES             Location/Qualifiers
     source          1..537
                     /db_xref="H-InvDB:HIT000032992"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:12369 IMAGE:4071612"
                     /tissue_type="Liver"
                     /clone_lib="NIH_MGC_76"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..537
                     /gene="SAA1"
                     /gene_synonym="PIG4"
                     /gene_synonym="SAA"
                     /gene_synonym="TP53I4"
                     /db_xref="GeneID:6288"
                     /db_xref="MIM:104750"
     CDS             38..406
                     /gene="SAA1"
                     /gene_synonym="PIG4"
                     /gene_synonym="SAA"
                     /gene_synonym="TP53I4"
                     /codon_start=1
                     /product="SAA1 protein"
                     /protein_id="AAH07022.1"
                     /db_xref="GeneID:6288"
                     /db_xref="MIM:104750"
                     /translation="MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMRE
                     ANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADE
                     WGRSGKDPNHFRPAGLPEKY"
     misc_feature    95..403
                     /gene="SAA1"
                     /gene_synonym="PIG4"
                     /gene_synonym="SAA"
                     /gene_synonym="TP53I4"
                     /note="SAA_proteins; Region: Serum amyloid A protein"
                     /db_xref="CDD:pfam00277"
BASE COUNT          147 a          127 c          152 g          111 t
ORIGIN      
        1 agggacccgc agctcagcta cagcacagat cagcaccatg aagcttctca cgggcctggt
       61 tttctgctcc ttggtcctgg gtgtcagcag ccgaagcttc ttttcgttcc ttggcgaggc
      121 ttttgatggg gctcgggaca tgtggagagc ctactctgac atgagagaag ccaattacat
      181 cggctcagac aaatacttcc atgctcgggg gaactatgat gctgccaaaa ggggacctgg
      241 gggtgtctgg gctgcagaag cgatcagcga tgccagagag aatatccaga gattctttgg
      301 ccatggtgcg gaggactcac tggccgatca ggctgccgat gaatggggca ggagtggcaa
      361 agaccccaat cacttccgac ctgctggcct gcctgagaaa tactgagctt cctcttcact
      421 ctgctctcag gagatctggc tgtgaggccc tcagggcagg gatacaaagc ggggagaggg
      481 tacacaatgg gtatctaata aatacttaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa
//