LOCUS BC005901 1005 bp mRNA linear HUM 26-APR-2004
DEFINITION Homo sapiens microfibrillar associated protein 5, mRNA (cDNA clone
MGC:14490 IMAGE:4247343), complete cds.
ACCESSION BC005901
VERSION BC005901.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1005)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1005)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (02-APR-2001) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: CLONTECH
cDNA Library Preparation: CLONTECH Laboratories, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 21 Row: i Column: 6
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 4505088.
FEATURES Location/Qualifiers
source 1..1005
/db_xref="H-InvDB:HIT000032509"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:14490 IMAGE:4247343"
/tissue_type="Skeletal Muscle"
/clone_lib="NIH_MGC_81"
/lab_host="DH10B"
/note="Vector: pDNR-LIB"
gene 1..1005
/gene="MFAP5"
/gene_synonym="MAGP2"
/gene_synonym="MP25"
/db_xref="GeneID:8076"
/db_xref="MIM:601103"
CDS 55..576
/gene="MFAP5"
/gene_synonym="MAGP2"
/gene_synonym="MP25"
/codon_start=1
/product="MFAP5 protein"
/protein_id="AAH05901.1"
/db_xref="GeneID:8076"
/db_xref="MIM:601103"
/translation="MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTE
DPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVK
QCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLP
PCENVDLQRPNGL"
misc_feature 58..468
/gene="MFAP5"
/gene_synonym="MAGP2"
/gene_synonym="MP25"
/note="MAGP; Region: Microfibril-associated glycoprotein
(MAGP). This family consists of several mammalian
microfibril-associated glycoprotein (MAGP) 1 and 2
proteins. MAGP1 and 2 are components of elastic fibres.
MAGP-1 has been proposed to bind a C-terminal region of
tropoelastin, the soluble precursor of elastin. MAGP-2 was
found to interact with fibrillin-1 and -2, as well as
fibulin-1, another component of elastic fibres this
suggests that MAGP-2 may be important in the assembly of
microfibrils"
/db_xref="CDD:pfam05507"
BASE COUNT 316 a 225 c 185 g 279 t
ORIGIN
1 gacacattca gcagccaaag gactcggtgg aaagagcaga acaccataga caatatgtcg
61 ctcttgggac ccaaggtgct gctgtttctt gctgcattca tcatcacctc tgactggata
121 cccctggggg tcaatagtca acgaggagac gatgtgactc aagcgactcc agaaacattc
181 acagaagatc ctaatctggt gaatgatccc gctacagatg aaacagtttt ggctgttttg
241 gctgatattg caccttccac agatgacttg gcctccctca gtgaaaaaaa taccactgca
301 gagtgctggg atgagaaatt tacctgcaca aggctctact ctgtgcatcg gccggttaaa
361 caatgcattc atcagttatg cttcaccagt ttacgacgta tgtacatcgt caacaaggag
421 atctgctctc gtcttgtctg taaggaacac gaagctatga aagatgagct ttgccgtcag
481 atggctggtc tgccccctag gagactccgt cgctccaatt acttccgact tcctccctgt
541 gaaaatgtgg atttgcagag acccaatggt ctgtgatcat tgaaaaagag gaaagaagaa
601 aaaatgtatg ggtgagagga aggaggatct ccttcttctc caaccattga cagctaaccc
661 ttagacagta tttcttaaac caatcctttt gcaatgtcca gcttttaccc ctactcctta
721 cagtctctag aattaaatgt actcatttag acaacatatt aaatgcatat tttagccact
781 ttagagaaac ctcataggca cagagtttcc aagattaatt ttaagaatat cttcacgaac
841 ttgaccctcc tactccacat tgcaacattt ccatcagaca gcatttcaat tccagtatta
901 tgtatattgc aaattaaaca ttttaaaata tttttttcca atttatttct caaaataaaa
961 tgtcttttgt tctgataaaa aaaaagaaaa aaaaaaaaaa aaaaa
//