LOCUS       BC000821                 773 bp    mRNA    linear   HUM 13-JUN-2005
DEFINITION  Homo sapiens ring finger protein 187, mRNA (cDNA clone
            IMAGE:3453993), partial cds.
ACCESSION   BC000821
VERSION     BC000821.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 773)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 773)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-NOV-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 4 Row: b Column: 5
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis.
FEATURES             Location/Qualifiers
     source          1..773
                     /db_xref="H-InvDB:HIT000085886"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3453993"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_10"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            <1..773
                     /gene="RNF187"
                     /db_xref="GeneID:149603"
     CDS             <1..96
                     /gene="RNF187"
                     /codon_start=1
                     /product="RNF187 protein"
                     /protein_id="AAH00821.1"
                     /db_xref="GeneID:149603"
                     /translation="VIQGPRPCTFHVGPQILGRYLRCTIECRIWG"
BASE COUNT          158 a          215 c          209 g          191 t
ORIGIN      
        1 gtcatccagg gacccagacc ctgcaccttc catgtgggcc cacagatcct tggcaggtac
       61 ctgaggtgca ccattgagtg tcggatttgg ggttagcatc cagaaagaag aatgcgcatg
      121 acgctctgtg aaggctggaa ctcaggtctt cagggagaga aaggaagact ggattgcacc
      181 ttgatgcctc ctgaggaggc ggcccccctc ttgaggtggg cgtgggcccg gcccagcctt
      241 atccaagtcg ctctgtccac ctcccccttc ctggccccca ccccactcct gtgcctccca
      301 ggagccctcc ctgtgctcca cctgcctccg cagaaggaag cctctttctc tgtttccctg
      361 ggtgaggggg ctggcaggtg gctaacccca tttagcatct ccaggccctg ccatggtgtc
      421 tcatcttgct gttatctcta gctctttccc tcctcccatt tcctttagta gttgaatttt
      481 gcaaagcttg tagcagtagc tcagttgcct gcagcatcct tgtgtgtaga taaattagtc
      541 gacagaaact cagcactggg gacaggattg caaagtcggg gacatagatg cagacagttg
      601 ttgagatttg gggatagccg ggcttgtgag cggtgcccat ttccagatga agcctttcag
      661 cccttctgag tccccggccc ttggtgcgat gtctgtgagt ttgacctgcc cagcgtgtgg
      721 gctggctcaa tgctgaataa agtgggtttg tgtcaaaaaa aaaaaaaaaa aaa
//