LOCUS BC000585 2730 bp mRNA linear HUM 11-DEC-2003
DEFINITION Homo sapiens solute carrier organic anion transporter family,
member 3A1, mRNA (cDNA clone MGC:659 IMAGE:3163826), complete cds.
ACCESSION BC000585
VERSION BC000585.2
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2730)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 2730)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (15-NOV-2000) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT On Aug 19, 2003 this sequence version replaced BC000585.1.
Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: ATCC
cDNA Library Preparation: Rubin Laboratory
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: National Institutes of Health Intramural
Sequencing Center (NISC),
Gaithersburg, Maryland;
Web site: http://www.nisc.nih.gov/
Contact: nisc_mgc@nhgri.nih.gov
Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
Young,A., Zhang,L.-H. and Green,E.D.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 5 Row: o Column: 19
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 7706713.
FEATURES Location/Qualifiers
source 1..2730
/db_xref="H-InvDB:HIT000029752"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:659 IMAGE:3163826"
/tissue_type="Brain, neuroblastoma"
/clone_lib="NIH_MGC_19"
/lab_host="DH10B-R"
/note="Vector: pOTB7"
gene 1..2730
/gene="SLCO3A1"
/gene_synonym="OATP-D"
/gene_synonym="OATP3A1"
/gene_synonym="SLC21A11"
/db_xref="GeneID:28232"
CDS 54..2132
/gene="SLCO3A1"
/gene_synonym="OATP-D"
/gene_synonym="OATP3A1"
/gene_synonym="SLC21A11"
/codon_start=1
/product="SLCO3A1 protein"
/protein_id="AAH00585.1"
/db_xref="GeneID:28232"
/translation="MQGKKPGGSSGGGRSGELQGDEAQRNKKKKKKVSCFSNIKIFLV
SECALMLAQGTVGAYLVSVLTTLERRFNLQSADVGVIASSFEIGNLALILFVSYFGAR
GHRPRLIGCGGIVMALGALLSALPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEG
PDPDLICLNRTATNMMYLLLIGAQVLLGIGATPVQPLGVSYIDDHVRRKDSSLYIGIL
FTMLVFGPACGFILGSFCTKIYVDAVFIDTSNLDITPDDPRWIGAWWGGFLLCGALLF
FSSLLMFGFPQSLPPHSDPAMESEQAMLSEREYERPKPSNGVLRHPLEPDSSASCFQQ
LRVIPKVTKHLLSNPVFTCIILAACMEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLG
MTAIPCACLGIFLGGLLVKKLSLSALGAIRMAMLVNLVSTACYVSFLFLGCDTGPVAG
VTVPYGNSTAPGSALDPYSPCNNNCECQTDSFTPVCGADGITYLSACFAGCNSTNLTG
CACLTTVPAENATVVPGKCPSPGCQEAFLTFLCVMCICSLIGAMAQTPSVIILIRTVS
PELKSYALGVLFLLLRLLGFIPPPLIFGAGIDSTCLFWSTFCGEQGACVLYDNVVYRY
LYVSIAIALKSFAFILYTTTWQCLRKNYKRYIKNHEGGLSTSTEYQDIETEKTCPESH
SPSEDSFVRS"
misc_feature 228..1376
/gene="SLCO3A1"
/gene_synonym="OATP-D"
/gene_synonym="OATP3A1"
/gene_synonym="SLC21A11"
/note="OATP_C; Region: Organic Anion Transporter
Polypeptide (OATP) family, C-terminus. This family
consists of several eukaryotic Organic-Anion-Transporting
Polypeptides (OATPs). Several have been identified mostly
in human and rat. Different OATPs vary in tissue
distribution and substrate specificity. Since the
numbering of different OATPs in particular species was
based originally on the order of discovery, similarly
numbered OATPs in humans and rats did not necessarily
correspond in function, tissue distribution and substrate
specificity (in spite of the name, some OATPs also
transport organic cations and neutral molecules). Thus,
Tamai et al. initiated the current scheme of using digits
for rat OATPs and letters for human ones. Prostaglandin
transporter (PGT) proteins are also considered to be OATP
family members. In addition, the methotrexate transporter
OATK is closely related to OATPs. This family aligns
residues towards the C-terminus. The family OATP_N aligns
residues from similar proteins towards the N-terminus.
This family also includes several predicted proteins from
Caenorhabditis elegans and Drosophila melanogaster. This
similarity was not previously noted. Note: Members of this
family are described as belonging to the SLC21 family of
transporters"
/db_xref="CDD:pfam03137"
misc_feature 1590..2081
/gene="SLCO3A1"
/gene_synonym="OATP-D"
/gene_synonym="OATP3A1"
/gene_synonym="SLC21A11"
/note="OATP_N; Region: Organic Anion Transporter
Polypeptide (OATP) family, N-terminus. This family
consists of several eukaryotic Organic-Anion-Transporting
Polypeptides (OATPs). Several have been identified mostly
in human and rat. Different OATPs vary in tissue
distribution and substrate specificity. Since the
numbering of different OATPs in particular species was
based originally on the order of discovery, similarly
numbered OATPs in humans and rats did not necessarily
correspond in function, tissue distribution and substrate
specificity (in spite of the name, some OATPs also
transport organic cations and neutral molecules). Thus,
Tamai et al. initiated the current scheme of using digits
for rat OATPs and letters for human ones. Prostaglandin
transporter (PGT) proteins are also considered to be OATP
family members. In addition, the methotrexate transporter
OATK is closely related to OATPs. This family aligns
residues towards the N-terminus. The family OATP_C aligns
residues from similar proteins towards the C-terminus.
This family also includes several predicted proteins from
Caenorhabditis elegans and Drosophila melanogaster. This
similarity was not previously noted. Note: Members of this
family are described as belonging to the SLC21 family of
transporters"
/db_xref="CDD:pfam03132"
BASE COUNT 561 a 810 c 746 g 613 t
ORIGIN
1 ggggcgagcg ggaaagcggc agcggcggcg gcggcggcgg cggcggggga aggatgcagg
61 ggaagaagcc gggcggttcg tcgggcggcg gccggagcgg cgagctgcag ggggacgagg
121 cgcagaggaa caagaaaaag aaaaagaagg tgtcctgctt ttccaacatc aagatcttcc
181 ttgtgtccga gtgcgccctg atgctggcgc agggcacggt gggcgcctac ctggtgagcg
241 tcctgaccac cctggagcgt aggttcaacc tgcagagcgc tgacgtgggt gtgatcgcta
301 gcagcttcga gatcgggaac ctggcgctca tcctcttcgt gagctacttc ggggcacgcg
361 ggcaccggcc gcgcctgatc ggctgcggcg gcatcgtcat ggcgctgggc gcgctgctgt
421 cggcgctgcc cgagttcctg acccaccagt acaagtacga ggcgggcgag atccgctggg
481 gcgccgaggg ccgcgacgtc tgcgcagcca acggctcggg cggcgacgag gggcccgacc
541 ccgacctcat ctgcctcaac cggacggcta ccaacatgat gtacttgctg ctcattgggg
601 cccaggtgct cctgggcatc ggtgctaccc ctgtgcagcc cctgggcgtc tcctacatcg
661 acgaccacgt gcggaggaag gactcctcgc tctatatagg aatcctgttc acgatgctgg
721 tatttggacc agcctgcggg tttatcctgg gctctttctg taccaaaatc tacgtggatg
781 cagtcttcat tgacacaagt aacctggaca tcactccgga cgacccccgc tggatcggag
841 cctggtgggg tggctttctg ctctgcggtg ccttactctt cttctcttcc ctcttgatgt
901 ttgggtttcc acagtccctg cccccgcact cagaccccgc catggaaagc gagcaggcca
961 tgctctccga aagagaatac gagagaccca agcccagcaa cggggtcctg aggcaccccc
1021 tggagccaga cagcagtgcc tcctgtttcc agcagctgag agtgatcccg aaggtcacca
1081 agcacctgct ctcaaaccct gtgttcacct gcatcatcct ggccgcctgc atggagattg
1141 cagtggtggc tggcttcgct gcctttttgg ggaagtacct ggagcagcag tttaacctca
1201 ccacctcttc tgccaaccag ctgcttggga tgactgcgat cccgtgtgct tgtctgggta
1261 tcttcctggg aggtcttttg gtgaagaagc tcagcctgtc tgccctgggg gccattcgga
1321 tggccatgct cgtcaacctg gtgtccactg cttgctacgt ctccttcctc ttcctgggct
1381 gcgacactgg ccctgtggct ggggttactg ttccctatgg aaacagcaca gcacctggct
1441 cagccctgga cccctactcg ccctgcaata ataactgtga atgccaaacc gattccttca
1501 ctccagtgtg tggggcagat ggcatcacct acctgtctgc ctgctttgct ggctgcaaca
1561 gcacgaatct cacgggctgt gcgtgcctca ccaccgtccc tgctgagaac gcaaccgtgg
1621 ttcctggaaa atgccccagt cctgggtgcc aagaggcctt cctcactttc ctctgtgtga
1681 tgtgtatctg cagcctgatc ggtgccatgg cacagacacc ctcagtcatc atcctcatca
1741 ggacagtcag ccctgaactc aagtcttacg ctttgggagt tctttttctc ctccttcgtt
1801 tgttgggctt catccctcca cccctcatct tcggggctgg catcgactcc acctgcctgt
1861 tctggagcac gttctgtggg gagcaaggcg cctgcgtcct ctacgacaat gtggtctacc
1921 gatacctgta tgtcagcatc gccatcgcgc tcaaatcctt cgccttcatc ctgtacacca
1981 ccacgtggca gtgcctgagg aaaaactata aacgctacat caaaaaccac gagggcgggc
2041 tgagcaccag cacagagtac caagacattg agactgagaa aacctgcccc gaatcacatt
2101 caccttcaga agactccttt gtgagaagct gagggcctgg ccctcttcct cttcctggag
2161 agaacagccc tccaccaccc acagacctcg cgggcctcac ttagcgtgct cctccctgtc
2221 cgagaacccg agggtcccca tgtggattat ccagccagtg tgtggtcctt tgaggcccca
2281 agcgcaggcc tgtgatgagg accaaagagg tgacttatgg tcaggagtac tccaaacagc
2341 tctcagagta ggcatctttc ctgggtctct aaagagtcat gctgacctgg tgtgcaaatt
2401 cccttccacc catccctcta cctcctctgg ggatggcttg ccgacatgct ttagaaactc
2461 ccctcttggg aatgctcctc tgactgaggg ctccaacagc tttaatgaaa tcagccgaga
2521 gggtaaaaac caacctgttg catagaatgg aggggggaaa aagcacatac tcaatagatt
2581 tttgagtgtg gtactctgta tttttgcagc gtttattttc caaatgagca gtttagaaat
2641 atgtgatgta aagtacatac tgtacgtttg ctgaaaatta tattaaaagc actattttaa
2701 ttcttaaaaa aaaaaaaaaa aaaaaaaaaa
//