LOCUS BC000113 2366 bp mRNA linear HUM 24-FEB-2004
DEFINITION Homo sapiens zinc finger protein 554, mRNA (cDNA clone
IMAGE:3352566), partial cds.
ACCESSION BC000113
VERSION BC000113.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2366)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 2366)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (03-NOV-2000) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: ATCC
cDNA Library Preparation: Rubin Laboratory
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Genome Sequence Centre,
BC Cancer Agency, Vancouver, BC, Canada
info@bcgsc.bc.ca
Steve Jones, Sarah Barber, Mabel Brown-John, Yaron Butterfield,
Andy Chan, Steve S. Chand, William Chow, Alison Cloutier, Ruth
Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
Kim MacDonald, Amara Masson, Mike R. Mayo, Josh Moran, Ryan Morin,
Teika Olson, Diana Palmquist, Anca Petrescu, Anna Liisa Prahbu,
Parvaneh Saeedi, JR Santos, Angelique Schnerch, Ursula Skalska,
Duane Smailus, Jeff Stott, Miranda Tsai, George Yang, Jacquie
Schein, Asim Siddiqui, Rob Holt, Marco Marra.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 6 Row: c Column: 15
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 22748680.
FEATURES Location/Qualifiers
source 1..2366
/db_xref="H-InvDB:HIT000085791"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="IMAGE:3352566"
/tissue_type="Eye, retinoblastoma"
/clone_lib="NIH_MGC_16"
/lab_host="DH10B-R"
/note="Vector: pOTB7"
gene <1..2366
/gene="ZNF554"
/gene_synonym="FLJ34817"
/db_xref="GeneID:115196"
CDS <1..1726
/gene="ZNF554"
/gene_synonym="FLJ34817"
/codon_start=2
/product="ZNF554 protein"
/protein_id="AAH00113.1"
/db_xref="GeneID:115196"
/translation="RSRAEEASQGHAGEAGRPARGAPASGALSGASARAPMVTCAHLG
RRARLPAAQPSACPGTCFSQEERMAAGYLPRWSQELVTFEDVSMDFSQEEWELLEPAQ
KNLYREVMLENYRNVVSLEALKNQCTDVGIKEGPLSPAQTSQVTSLSSWTGYLLFQPV
ASSHLEQREALWIEEKGTPQASCSDWMTVLRNQDSTYKKVALQEEPASGINMIKLIRE
DGGWKQLEDSHEDPQGLLSQKASLHVVAVPQEKATAWHGFGENGNLSPALVLSQGSSK
GNHLCGSELDITSLASDSVLNHHQLGYADRRPCESNECGNAIRQNSHFIQHGGKMFVY
LENGQSLNHGMALTIHNKINTAEKPFECHQCGKVFNRRHSLSEHQRIHTGEKPYECQE
CGRAFTHSSTLTRHLRTHTGEKPYGCGECGKAFNRISSLTQHQRIHTGEKPYKCEDCG
KSFCQSSYLILHKRTHTGEKPYECSECGKAFSDRSSLNQHERTHTGENPYECKQCGRA
FSQRSSLVRHERTHTGEKPYRCQECGKAFSQSSSLVTHQKTHSSQKTYKIIDCGKAFY
QNRHLIGY"
misc_feature 242..364
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="KRAB; Region: KRAB box. The KRAB domain (or
Kruppel-associated box) is present in about a third of
zinc finger proteins containing C2H2 fingers. The KRAB
domain is found to be involved in protein-protein
interactions. The KRAB domain is generally encoded by two
exons. The regions coded by the two exons are known as
KRAB-A and KRAB-B"
/db_xref="CDD:pfam01352"
misc_feature 1163..1231
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 1331..1399
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 1415..1483
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
misc_feature 1583..1651
/gene="ZNF554"
/gene_synonym="FLJ34817"
/note="zf-C2H2; Region: Zinc finger, C2H2 type. The C2H2
zinc finger is the classical zinc finger domain. The two
conserved cysteines and histidines co-ordinate a zinc ion.
The following pattern describes the zinc finger.
#-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be
any amino acid, and numbers in brackets indicate the
number of residues. The positions marked # are those that
are important for the stable fold of the zinc finger. The
final position can be either his or cys. The C2H2 zinc
finger is composed of two short beta strands followed by
an alpha helix. The amino terminal part of the helix binds
the major groove in DNA binding zinc fingers"
/db_xref="CDD:pfam00096"
BASE COUNT 633 a 584 c 647 g 502 t
ORIGIN
1 gaggagccga gcggaggagg cgtcccaggg acacgcaggg gaggccggcc ggcctgcacg
61 gggcgctccc gcctcggggg ccctgtctgg cgcctcagcg cgcgccccga tggtcacctg
121 cgcccacctg ggccggcgcg cgcggctccc ggcagctcag ccctctgcct gcccaggaac
181 ctgcttttcc caagaggaga gaatggctgc tgggtacctg ccccgctggt cccaggaatt
241 agtaaccttt gaggacgtgt ccatggactt ctcccaggag gagtgggagt tgctggagcc
301 tgctcagaag aacctgtaca gagaggtgat gctggagaac tacaggaacg tggtctccct
361 ggaagccttg aagaaccaat gtactgatgt ggggattaaa gagggtccac tttccccagc
421 acaaacctca caagtcacta gtctttcctc atggacgggg tatttacttt ttcaaccagt
481 ggcttcttcc cacttggagc aaagagaagc cctgtggata gaggaaaaag gaactcctca
541 agcctcctgt tcagattgga tgactgtact aagaaaccaa gactcaactt acaagaaggt
601 ggctttgcag gaggaaccag ccagtggtat aaatatgata aagcttatca gagaagatgg
661 gggatggaag cagttagagg acagccatga agacccccag gggcttttga gccaaaaggc
721 atcccttcac gtagtggccg ttcctcagga gaaggctact gcatggcatg gatttgggga
781 aaatggtaat ctgagcccag cccttgtttt atcacaggga agctctaaag ggaaccactt
841 gtgtggcagc gagttagata ttacaagctt ggcatccgat tcagtcttaa accaccatca
901 gctgggatat gcagatcgga gaccttgtga aagtaatgaa tgtggaaatg ccatccgcca
961 gaacagtcac tttattcaac acggggggaa gatgtttgtg tatttggaaa atgggcagtc
1021 attgaaccac ggtatggccc tgactatcca caacaaaatc aacacggcag agaaaccctt
1081 tgagtgccac cagtgtggga aggtgttcaa ccggaggcat tctttgagcg aacatcaaag
1141 aattcacacg ggggagaaac cctacgagtg tcaggagtgt gggcgagcct ttacgcacag
1201 ctccaccctc acgcgccatc tgagaactca tactggagag aagccctacg ggtgcggtga
1261 gtgcgggaaa gccttcaaca ggatctcatc gctgactcag catcagagga ttcacaccgg
1321 ggaaaagccc tataaatgtg aagactgtgg gaaatccttc tgccagagct cttacctgat
1381 cttgcacaag aggacacaca ccggagagaa gccctacgaa tgcagtgaat gtggaaaggc
1441 cttcagtgac cgttcctctc tcaaccagca cgagcgaact cacacgggcg agaaccccta
1501 tgaatgtaag cagtgtggga gagccttcag ccagaggtct tcccttgtga ggcacgagag
1561 aactcacact ggagagaaac cctacaggtg tcaggaatgt gggaaagcct tcagccagag
1621 ctcatccctt gtcacacatc agaaaactca cagcagccag aaaacctata aaatcattga
1681 ctgcgggaaa gcgttctacc agaacagaca tcttattgga tattagcaat tgcacgctgc
1741 tttgtaagcc actttttagt actctgacac atacatgtgg ttatcttttg ccctgttgtg
1801 atggataatt tgaaaagaag tgggtttatg tcaccttctc accttcttat aagaaagctc
1861 tgagaatggg catttttgta ttttgttgtt gttgttgaga tggagtctgc cacccaggct
1921 ggagtccagt ggcgtgatca tacctcactg cagcttcagc ttcctgggct caagtaatcc
1981 tcccacccca gcctcccagg tagctagtac tataggtgtg caccaccacg cccagcaaat
2041 ttttaaattt attatagagt gggaggcagg gtgcggtggc tcatgcctat aatcctaaca
2101 ctttgggagg ccgaggcggg tggatcatga ggtcaggaga tcgagaccat cctggctaac
2161 acagtgaaac cctgtctcta ctaaaaatac aaaaaagtag ccgggcgtgg tggtgggcgc
2221 ctgtagtccc aactactcag gaggctgagg caggagaatg gtgtgaaccc gggaggtgga
2281 gcttgcagtg agccaagatc gcaccactgc actccagcct gggagacaga gcgagactcc
2341 gtctcaaaaa aaaaaaaaaa aaaaaa
//