LOCUS       X70124                   630 bp    DNA     linear   VRL 18-APR-2005
DEFINITION  A.californica gp67 gene.
ACCESSION   X70124
VERSION     X70124.1
KEYWORDS    cysteine endopeptidase; envelope glycoprotein gp67; evolution;
            papain.
SOURCE      Autographa californica nucleopolyhedrovirus
  ORGANISM  Autographa californica nucleopolyhedrovirus
            Viruses; Baculoviridae; Alphabaculovirus.
REFERENCE   1  (bases 1 to 630)
  AUTHORS   Rawlings N.D., Pearl L.H., Buttle D.J.
  TITLE     The baculovirus Autographa californica nuclear polyhedrosis virus
            genome includes a papain-like sequence
  JOURNAL   Biol. Chem. Hoppe-Seyler 373(12), 1211-1215(1992).
   PUBMED   1363350
FEATURES             Location/Qualifiers
     source          1..630
                     /organism="Autographa californica nucleopolyhedrovirus"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:46015"
     CDS             join(<1..83,85..630)
                     /codon_start=3
                     /gene="gp67"
                     /product="envelope glycoprotein"
                     /db_xref="GOA:P25783"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013201"
                     /db_xref="InterPro:IPR025660"
                     /db_xref="InterPro:IPR025661"
                     /db_xref="InterPro:IPR038765"
                     /db_xref="InterPro:IPR039417"
                     /db_xref="UniProtKB/Swiss-Prot:P25783"
                     /protein_id="CAA49713.1"
                     /translation="IHWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINL
                     SEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQ
                     VKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVG
                     YGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY"
     misc_feature    84
                     /note="assumed to be a sequencing error"
BASE COUNT          189 a          123 c          146 g          172 t
ORIGIN      
        1 gaattcactg gcgtcgtctc aacaaagtca ctagcgtaaa aaatcagggc atgtgtggcg
       61 cctgctgggc gtttgccact ctgagctagt ttggaaagtc aatttgcaat caaacataac
      121 cagttgatta atctgtcgga gcagcaaatg atcgattgtg attttgtcga cgctggctgt
      181 aacggcggct tgttgcacac agcgttcgaa gccatcatta aaatgggcgg cgtacagctg
      241 gaaagcgact atccatacga agcagacaat aacaattgcc gtatgaactc caataagttt
      301 ctagttcaag taaaagattg ttatagatac attaccgtgt acgaggaaaa acttaaagat
      361 ttgttacgcc ttgtcggccc tattcctatg gccatagacg ctgccgacat tgttaactat
      421 aaacagggta ttataaaata ttgtttcaac agcggtctaa accatgcggt tcttttagtg
      481 ggttatggtg ttgaaaacaa cattccatat tggaccttta aaaacacttg gggcacggat
      541 tggggagagg acggattttt cagggtacaa caaaacataa acgcctgtgg tatgagaaac
      601 gaacttgcgt ctactgcagt catttattaa
//